Conserved Protein Domain Family
PLN02994

?
PLN02994: PLN02994 
1-aminocyclopropane-1-carboxylate synthase
Statistics
?
PSSM-Id: 166635
View PSSM: PLN02994
Aligned: 2 rows
Threshold Bit Score: 307.319
Threshold Setting Gi: 225468935
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15241776    3 QGACEnqlLSKLALSDKHGEASPYFHGWKAYDNNPFHPTHNPQGVIQMGLAENQLCSDLIKEWIKEnpHASICTAEG-ID 81 
225468935   1 MGFCS---LSTLAMADRHGEDSPYFAGWKAYDLNPYDLLYNPSGIIQMGLAENQVGTDLLEEWLEK--HSDIPTWKGtLT 75 
15241776   82 SFSDIAVFQDYHGLKQFRQAIATFMERARGGRVRFEAERVVMSGGATGANETIMFCLADPGDAFLVPTPYYAA 154
225468935  76 SFKQTALYQDYHGLANFRKALANFMAEVRGRRVKIDPDMIVLTAGATAGNEILTFCIADPGEALLVPTPYYPG 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap