Conserved Protein Domain Family
PLN02987

?
PLN02987: PLN02987 
Cytochrome P450, family 90, subfamily A
Statistics
?
PSSM-Id: 166628
View PSSM: PLN02987
Aligned: 4 rows
Threshold Bit Score: 949.418
Threshold Setting Gi: 15239203
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225448402   1 MDWSLAVTIGAALLAIFFLFLRLTRPRGHRLPPGNLGLPLVGETLQLISAYKSANPEPFIDERVTRYGPLFTTHVFGEPT 80 
15239203    1 MAFTAFLLLLSSIAAGFLLLLRRTRYRRMGLPPGSLGLPLIGETFQLIGAYKTENPEPFIDERVARYGSVFMTHLFGEPT 80 
224098545   1 MAVSVCLVLFIVLPAIVFIVHRSSRFRRLRLPPGSLGLPFVGETLQLISAYKTENPEPFIDERVNRFGSLFKTHIFGEPT 80 
297810671   1 MAFTAFLLLLSSIAAGFLLLLRRTRYRRMGLPPGSLGLPLIGETFQLIGAYKTENPEPFIDERVARYGSVFMTHLFGEPT 80 
225448402  81 VFSADPETNRYILQNEGKLFECSYPGSISNLLGRHSLLLMKGNLHKKMHSLTMSFGNSSIIKDHLLLDIDRLIRFNMDSW 160
15239203   81 IFSADPETNRFVLQNEGKLFECSYPASICNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFNLDSW 160
224098545  81 VFSVDPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLMTGNLHKKMHSLTMSFANSSIIRDHLLVDIDRLIRLNLDSW 160
297810671  81 VFSADPETNRFVLQNEGKLFECSYPASICNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFNLDSW 160
225448402 161 TSRILLMEEAKKITFDLTVKQLMSFDPGEWTESLRKEYVLVIEGFFTVPFPLFSATYRRAIQARTKVAEALNLVVRERRK 240
15239203  161 SSRVLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEYLLVIEGFFSLPLPLFSTTYRKAIQARRKVAEALTVVVMKRRE 240
224098545 161 SDRVLLMEEAKKTTFELTMKQLMSFDPCEWTESLRREYVLVIEGFFSVPLPILSPTYRRAIKARTKVAEALSLVVKQRRI 240
297810671 161 SSRVLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEYLLVIEGFFSLPLPLFSTTYRKAIQARRKVAEALTVVVMKRRD 240
225448402 241 AKEEGeEEKKNDMLAALLDSGD--NFSDEQIVDFILALLVAGYETTSTIMTLAIKFLTETPLALAQLREEHDEIRARISD 318
15239203  241 EEEEG-AERKKDMLAALLAADD--GFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSD 317
224098545 241 ESESG--EKKKDMLGALLASDDhgGFSDEEIVDFLVALLVAGYETTSTSMTLAVKFLTETPLALAQIKEEHEQIRGKKGE 318
297810671 241 EEEEG-AERKKDMLAALLAADD--GFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSD 317
225448402 319 PNVLEWSDYKSMPFTQCVVNETLRVANIIGGIFRRVTTDIHVKGYTIPKGWKVFASFRAVHLDHEYFKDARTFNPWRWql 398
15239203  318 SYSLEWSDYKSMPFTQCVVNETLRVANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHLDPNHFKDARTFNPWRW-- 395
224098545 319 EGALEWSDYKSMTFTQCVVNETLRIANIIGGIFRRTMTDINVKGYTIPKGWKVFASFRGVHLDHEYFKDARTFNPWRW-- 396
297810671 318 SYSLEWSDYKSMPFTQCVVNETLRVANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHLDPNHFKDARTFNPWRW-- 395
225448402 399 QNNSGPTVPGsgvNVFTPFGGGPRLCPGYELARVVLSVFLHRMVTRYSWAPAEEDKLVFFPTTRTQKRYPINVERRKVSS 478
15239203  396 QSNSVTTGPS---NVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWVPAEQDKLVFFPTTRTQKRYPIFVKRRDFAT 472
224098545 397 QDDSGATCPA---NVFTPFGGGQRLCPGYELARVELSVFLHHLVTRFSWTPAEQDKLVFFPTTRTQKRYPINVQRRNRV- 472
297810671 396 QSNSVTTSPS---NVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWVPEEQDKLVFFPTTRTQKRYPIFVKRRDVAT 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap