Conserved Protein Domain Family
PLN02975

?
PLN02975: PLN02975 
complex I subunit
Statistics
?
PSSM-Id: 166616
View PSSM: PLN02975
Aligned: 10 rows
Threshold Bit Score: 133.092
Threshold Setting Gi: 255560096
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255071675   1 MGVIGDNPSYPVVDRAPTFGTVVGNFNATDYRDWATWTAVSFPVGWMSGAmsGPGIRVPAMYASGLIGGLAGFMWAYQSS 80 
186511907   4 DITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLSGI--KPGIKGPSMVTGGLIGLMGGFMYAYQNS 81 
168034437   1 MGIFLDEPKFPVIERNPTASSTISNFSFSDYVRIAAFTGGSLPVGYLAGG--SVNIRGPSMYTAGIIGLMGGFMYAYQCS 78 
115476534  40 DITASVKPEYPVVDRNPPFTKVVGNFSALDYLRLSTISAVSVTVGYLSGI--KPGIRGPSMVTGGLIGVMGGFMYAYQNS 117
225460763   4 DITASEKPQYPVIDRNPPLTKVVGNFSALDYLRFVTITGVSVTVGYLSGI--KPNIRGPSMVTGGLIGIMGGFMYAYQNS 81 
224089721   4 DITASAKPEYPVIDRNPEFTKVVGNFNTLDYCRFITLTGVSVTVGYLSGI--KPGIKGPSMVTGGLIGLMGGFMYAYQNS 81 
224137260   4 DITASAKPEYLVIDRNPAFTKVVGNFNTLDYCRFITLTGVSVTVGYLSGI--KPGLKGPSMVTGGLIGLMGGFMYAYQNS 81 
242079233   4 DITASTKPEYPVVDRNPAFTKVVGNFSALDYMRLSTISAVSVTVGYLSGI--KPGIRGPSMVTGGLIGVMGGFMYAYQNS 81 
255560096   4 DITASVKPEYPVIDRNPPFTKVV-------------------------GI--KPGIKGPSMVTGGLIGLMGGFMYAYQNS 56 
297804546   4 DITALEKPQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLSGI--KPGIKGPSMVTGGLIGLMGGFMYAYQNS 81 
255071675  81 GGRLMGFLPNEAEVRSAGR 99 
186511907  82 AGRLMGFFPNDGEVASYQK 100
168034437  79 AGRLMGMFPNDDEVARHNR 97 
115476534 118 AGRLMGFFPNDSEVARYKY 136
225460763  82 AGRLMGFFPNEDEVARYKK 100
224089721  82 AGRLMGFFPNEGEVARYQK 100
224137260  82 AGRLMGFFPNEGEVARYQK 100
242079233  82 AGRLMGFFPNDAEVARYKY 100
255560096  57 AGRLMGFFPNEGEVAHYQK 75 
297804546  82 AGRLMGFFPNDGEVASYQK 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap