Conserved Protein Domain Family
PLN02971

?
PLN02971: PLN02971 
tryptophan N-hydroxylase
Statistics
?
PSSM-Id: 166612
View PSSM: PLN02971
Aligned: 4 rows
Threshold Bit Score: 1104.71
Threshold Setting Gi: 297821455
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42569237    1 MDTLASNSSDLTTKSSlGMSSFTNMYLLTTLQALAALCFLMILNKIKSSSRNKKLHpLPPGPTGFPIVGMIPAMLKNRPV 80 
15236088    1 MNTFTSNSSDLTTTAT-ETSSFSTLYLLSTLQAFVAITLVMLLKKLMTDPNKKKPY-LPPGPTGWPIIGMIPTMLKSRPV 78 
297821455   1 MDSLASNSSDLGTKSSpGTSSFTNMYLLTTFQALVAISLLMILKKLKSSSRNKKLHpLPPGPTGFPIVGMIPAMLKNRPV 80 
297798024   1 MNTFTSNSSDLTTTAT-ETSSFSTLYLLSTLQAFVAITLVMLLKKLMTDPNKKKLT-LPPGPTGWPIIGMIPTMLKSRPV 78 
42569237   81 FRWLHSLMKELNTEIACVRLGNTHVIPVTCPKIAREIFKQQDALFASRPLTYAQKILSNGYKTCVITPFGEQFKKMRKVI 160
15236088   79 FRWLHSIMKQLNTEIACVKLGNTHVITVTCPKIAREILKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVV 158
297821455  81 FRWLHSLMKELNTEIACVRLGNTYVIPVTCPKIAREIFKQQDALFASRPLTYAQKILSNGYKTCVITPFGEQFKKMRKVI 160
297798024  79 FRWLHSIMKQLNTEIACVRLGNTHVITVTCPKIAREMLKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVV 158
42569237  161 MTEIVCPARHRWLHDNRAEETDHLTAWLYNMVKNSEPVDLRFVTRHYCGNAIKRLMFGTRTFSEKTEADGGPTLEDIEHM 240
15236088  159 MTELVCPARHRWLHQKRSEENDHLTAWVYNMVKNSGSVDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGGPTVEDVEHM 238
297821455 161 MTEIVCPARHRWLHDNRAEETDHLTAWLYNMVKNSEPVDLRFVTRHYCGNAIKRLMFGTRTFSEKTETDGGPTLEDIEHM 240
297798024 159 MTELVCPARHRWLHQKRSEENDHLTAWVYNMVKNSGSVDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGGPTVEDVEHM 238
42569237  241 DAMFEGLGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGKRTQIEDFLDIFISIKDEAGQ 320
15236088  239 EAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGKRTQIEDFLDIFISIKDEQGN 318
297821455 241 DGMFEGLGFTFAFCVSDYLPILTGLDLNGHEKIMREASAIMDKYHDPIIDERIKMWREGQRTKIEDFLDIFISIKDEAGQ 320
297798024 239 EAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGKRTQIEDFLDIFISIKDEQGN 318
42569237  321 PLLTADEIKPTIKELVMAAPDNPSNAVEWAIAEMINKPEILHKAMEEIDRVVGKERFVQESDIPKLNYVKAIIREAFRLH 400
15236088  319 PLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLH 398
297821455 321 PLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMINKPEILHKAMEEIDRVVGKERFVQESDIPKLNYLKAIIREAFRLH 400
297798024 319 PLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLH 398
42569237  401 PVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCA 480
15236088  399 PVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLCFKPERHLNECSEVTLTENDLRFISFSTGKRGCA 478
297821455 401 PVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCA 480
297798024 399 PVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCA 478
42569237  481 APALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHDMFLSKPLVLVGELRLSEDLYPMVK 543
15236088  479 APALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGDLRLPEHLYPTVK 541
297821455 481 APALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHDMFLSKPLVMVGELRLSEDLYPTVK 543
297798024 479 APALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGELRLPEHLYPTVK 541
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap