Conserved Protein Domain Family
PLN02869

?
PLN02869: PLN02869 
fatty aldehyde decarbonylase
Statistics
?
PSSM-Id: 166510
View PSSM: PLN02869
Aligned: 7 rows
Threshold Bit Score: 1161.53
Threshold Setting Gi: 30678265
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30678265    1 MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILHNQVWISLSRYYTSSGKRRIV 80 
225454040   1 MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLHNQIWISLARYRTAKGNNRIV 80 
225454042   1 MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALHNQIWISLARYRTAKGNNRIV 80 
225470136   1 MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIYSFVVKDEKERDISHFLIFPFLLWRMLHNQLWISLSRHRTAKGNNRIV 80 
225470140   1 MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLWRMLHNQLWISLSRHRTAKGNNRIV 80 
224129430   1 MASRPGILTDWPWKPLGSFKHVILAPWVIHSTYSFMIKDG--KDLSTFLAFPLLLWRMLHNQLWISLSRYRTAKGNNRII 78 
255571123   1 MASMPGVFSEWPWKPLGSFKHVVLAPWVINHIYSIVVKGE--KENPSYLIFPFLLWRMVHNQLWISLSRYRTAKGNNRII 78 
30678265   81 DKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLPWWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHS 160
225454040  81 DKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMPLWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHS 160
225454042  81 DKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMPLWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHS 160
225470136  81 DKGIEFEQVDRERNWDDQIIFNGIIFYITYFTVPGGTHMPFWRADGVVITILLHMGPVEFLYYWFHRALHHHYLYSRYHS 160
225470140  81 DKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMPLWRVDGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHS 160
224129430  79 DKAIEFDQVDRESSWDDQILFNGILFYVGIHTIPGASHLPMWRLDGVIITALIHMGPVEFLYYWLHRLLHHHYLYSRYHS 158
255571123  79 DKGIEFDQVDRERNWDDQVLLNGILFYVGAMVIPQANRMPMWRADSIIITILLHIGPVEFLYYWFHRLLHHHYLYSRYHS 158
30678265  161 HHHSSIVTEPITSVIHPFAEHIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF 240
225454040 161 HHHSSIVTEPITSVIHPFAEHLAYFLLFSIPLLAGIFMRKNSIAALFGYISYIDFMNNMGHCNFELIPKMLFSIFPPLKY 240
225454042 161 HHHSSIVTEPITSVIHPFAEHLAYFLLFLIPLLAGFFMRKSSMAAVFGYISYIDFMNNMGHCNFELIPKMLFSIFPPLKY 240
225470136 161 HHHSSIVTEPITSVIHPFAEHIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY 240
225470140 161 HHHSSIVTEPITSVIHPFAEHIGYFLLFSIPLLTMIFTGTSCIVAFFGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY 240
224129430 159 HHHSSIVTEPITSVIHPFAEHISYFILFAIPLITTILTGTASVASLAGYITYIDVMNNMGHCNFELVPKWLFTIFRPLKY 238
255571123 159 HHHSSIVTEPITSVIHPFAEHLAYFILFAIPLLTTVLSGTASVAAYCGYITYIDFMNNMGHCNFELIPKSFFSIFPPLKY 238
30678265  241 LCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGDDIVDVVHLTHLTTPESIYHLRIGLASFASYP 320
225454040 241 LMYTPSYHSLHHTRFRTNYSLFMPIYDYIYGTMDKSSDALYEKSLIRPEELLHVVHLTHLVTPQSIYHLRLGFASLASKP 320
225454042 241 LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDALYEKSLIRPEQLPHVVHLTHLVTPQSIYHLRLGFASLASKP 320
225470136 241 LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTVDKSSDVLYEKSLTRPEESPDVVHLTHLTTPDSIYHMRLGFASVASKP 320
225470140 241 LMYTPSYFTLHHTQFRTNYSLFMPFYDYMYGTMDRSSDVLYEKSLTRPEESPDVVHLTHLTTPDSIYHIRLGFAFVASKP 320
224129430 239 LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEDSLKRPEEAPDVVHLTHLTTPDSIYHSRLGLAYLASNP 318
255571123 239 LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDSLYESSLKRQEEIAHVVHLTHMTTPDSIYHLRLGFAYLASIP 318
30678265  321 FAYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFNKLNLQSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVL 400
225454040 321 YTYRWYVWAMWPVTCGSIMLTWTYGRTFILERNQFNKVNVQTWVVPKFKIQYLLKLGNESIDSLIEEAILKADKRGIKVL 400
225454042 321 YTYKWYVWAMWPVTCCSIMLTWTYGRTFILERNQFNKVNVQTWVVPKFKIQYLLKLGNESIDSLIEEAILKADKRGIKVL 400
225470136 321 YISKWYLRLMWPLTSWYMMLIWICSRTFVLERNHFNKLKLQTWVIPKYRIQYFLKGQNEPINSLIEEAILDADQRGVKVL 400
225470140 321 YISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKLQTWVIPKYRIQYFLKWQNEPINSLIEEAILHAEERGVKVL 400
224129430 319 QKSKWYLSLMWPVTLWTMMLTWIYGRAFVVERNRFHKLRLQTWTIPKYNIQYNLRWHTASINTLIEEAVLEAEEKGVKVL 398
255571123 319 QSSKWYLWLMWPVTLWTMIFARIYGRTFLLERHRFDKLRLQTWVIPKYKIQYTIQWQNESINKMIEQSILEAEAKGVKVL 398
30678265  401 SLGLMNQGEELNRNGEVYIHNHPDMKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLRL 480
225454040 401 SLSLLNQGDELNSYGELYIHRNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSHG 480
225454042 401 SLGLLNQGDEFNSYGELYIHNNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSRK 480
225470136 401 SLGILNQGEELNIYGELYIHRNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFHE 480
225470140 401 SLGLLNQGEELNLYGKLYIHLNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFRE 480
224129430 399 SLGLLNQAKELNRYGELYVQRYPRLKTKVVDGSSLAVAAVLNSIPKGTTQVLHRGNLSKVAYAVVLNLCRRGIQVAVPYE 478
255571123 399 SLGLLNQGEELNRYGEAYMVKHPRLGIKVVDGSSLAVAVVLNSIPKGTTQLLFRGRLSKVAFAVVLGLCQRGIQVATTLK 478
30678265  481 DEYEKIRSCVPQECRDHLVYLTSEALSSnkVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIVPKS 560
225454040 481 DEYEQLNTKLKNVECESKLLLSKSFTEK--IWLVGDGLTKEEQIKASKGTLFIPFSQFPPKRLRKDCLYLTTPAMMSPKS 558
225454042 481 DEYEQLNTKLKNVECESKLLLSKSFTEK--IWVVGDGLTKEEQMKASTGTLFIPFSQFPPKRLRKDCLYHTTPAMMPPKS 558
225470136 481 EEYANINMKL-NTKLGGKLALSKNYAHKvqIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTS 559
225470140 481 EEHKKIKMKL-NTKLRDKLALSKNY-----IWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTS 554
224129430 479 DDYKRLKKSFGSRSDQNNLILSKNYSIK--TWLVGDGLKGEDQKKATEGTLFIPFSQFPPKKLRKDCFYHSTPAMAAPAS 556
255571123 479 EDYEKLIKASPNSECGKNVLLSKNYSLK--TWLVDDGLREEEQKKASKGTVFIPVSQFPPKKARNDCFYYSTPAVVAPSA 556
30678265  561 LVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLlsDLDQVWEACLSHGFQPLLLPH 624
225454040 559 FQNIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMF--NIEKIWEASLHHGFRPLTIPT 620
225454042 559 FQNIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMF--NVEKIWEASLQHGFRPLTVPT 620
225470136 560 FEDMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIF--NIEKIWEASLQHGFRPLMIPS 621
225470140 555 FENMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIF--DIEKIWEASFQHGFRPLMIPS 616
224129430 557 LENVDSCENWLPRRVMSAWRVAGIVHALEGWNEHECGYTMS--DIDKVWQASIQHGFKPLVITA 618
255571123 557 LENVDSCENWLPRRVMSAWRAAGIVHGLEGWNVNECGYTMF--DVDRVWQATLCHGFKPLLLIP 618
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap