Conserved Protein Domain Family
PLN02846

?
PLN02846: PLN02846 
digalactosyldiacylglycerol synthase
Statistics
?
PSSM-Id: 166487
View PSSM: PLN02846
Aligned: 8 rows
Threshold Bit Score: 940.014
Threshold Setting Gi: 297810121
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115452143   1 MARKQHIAIFTTASLPWMTGTAVNPLFRAAYLAKAGDWEVTLVVPWLSKGDQLLVYPNKMKFSVPGEQEGYVRRWLEERI 80 
115451541   1 MSTRRHLAVFTTASLPWMTGTAINPLFRAAYLAKDGDREVTLVIPWLSLRDQELVYPNKIVFGSPLEHEAYVRRWIEERI 80 
22328179    3 NQQEQHIAIFTTASIPWLTGTAVNPLFRAAYLANDGERRVTLVIPWLTLKHQKLVYPNSITFSSPSEQEAYVRQWLEERV 82 
242036203   2 ARKQQHIAIFTTACLPWMTGTAVNPLFRAAYLAKAGNWEVTLVVPWLSKGDQELVYPNKMKFSSPAEQENYVRQWLEERT 81 
225454079   1 MDSKQHIAIFTTASLPWMTGTAVNPLFRVAYLTKGREFKVTLVIPWLSLKDQELVYPNKITFKSPSEQEAYVRQWLGERT 80 
224130208   2 DNKKQHIAIFTTASLPWMTGTAVNPLFRAAFLAKDGSRKVTLVIPWLSLQHQKLVYPNNITFTSPSEQQVYVRQWLQERI 81 
255541500   2 DQKQQHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGDRKVTLVIPWLSLKHQKLVYPKNITFSLPSEQEAYVRRWLEDRI 81 
297810121   4 QQQQQHIAIFTTASIPWLTGTAVNPLFRAAYLANDGDRRVTLVIPWLTLNHQKLVYPNSITFSSPSEHEAYVRHWLEERV 83 
115452143  81 GLLPKFEIKFYPGKFSTEKRSILPAGDITQTVSDDKADIAVLEEPEHLTWYHHGRRWKNKFRKVIGVVHTNYLEYVKRER 160
115451541  81 SFRPSFSIKFYPAKFSKELRSILPVGDITECIPDEVADVAVLEEPEHLNWYHHGRKWKNKFRRVIGVVHTNYIAYVKREK 160
22328179   83 SFRLAFEIRFYPGKFAIDKRSILPVGDISDAIPDEEADIAVLEEPEHLTWFHHGQKWKTKFNYVIGIVHTNYLEYVKREK 162
242036203  82 GPLPKFDIKFYPGKFSTEKRSILPVGDISQTISDDKADIAVLEEPEHLTWYHHGRRWKSKFPKVIGVVHTNYLEYVKREK 161
225454079  81 GFVCDFSIKFYPGKFSRDKRSILVVGDITEIIPDEEADIAVLEEPEHLTWYHHGKRWKTKFHLVLGIVHTNYLEYVRREK 160
224130208  82 SFSPAFSIQFYPAKFAVDKRSILSVGDISEVIPDEDADVAVLEEPEHLTWFHHGKRWKTKFRLVIGIIHTNYLEYIKREK 161
255541500  82 AFLCDFKLCFYPGKFAKDKGSILPVGDISDFISDEEADVAILEEPEHLTWFHHGKRWKTKFRLVIGIVHTNYLEYVKREK 161
297810121  84 SFPLGFEIRFYPGKFATDKRSILPVGDISDAIPDEEADIAALEEPEHLTWFHHGKKWKTKFNYVIGIVHTNYLEYVKREK 163
115452143 161 NGYIHAFLLKHINSWVTDIYCHKVIRLSAATQEVPRSIVCNVHGVNPKFIEIGKLK--HQQISQREQAFFKGAYYIGKMV 238
115451541 161 NGQAIACFMKYMNTWVTRIYCHKIIRLSGATQDLPRSVVCNVHGVNPKFLEVGKLK--LKQLRNGEIAFTKGAYYIGKMV 238
22328179  163 QGRVKAFFLKYLNSWVVGIYCHKVIRLSAATQEYPKSIVCNVHGVNPKFLEIGLRK--LEQQKLQEQPFTKGAYYIGKMV 240
242036203 162 NGYISAFILKHINSWVTDIYCHKVIRLSAATQDVPRSVICNVHGVNPKFIEIGKLK--HQELCQREQAFFKGAYYIGKMV 239
225454079 161 NGRLQAFLLKYINNWVVDIYCHKVIRLSAATQDLPRSIICNVHGVNPKFLEIGKRK--NEHQQNGDRAFTKGAYYIGKMV 238
224130208 162 HGRVKAVVVKYINSWVVEIYCHKVIRLSAATQDYPNSIICNVHGVNPKFLEIGKKKieLQQSGNGNQAFTKGAYYIGKMV 241
255541500 162 NGRLKALLLKYVNSWVVSIYCHKVIRLSAATQDYTKSIICNVHGVNPKFLEIGKKK--LEQQKNGDQPFTKGAYYIGKMV 239
297810121 164 QGRVKAFLLKYLNSWVVGIYCHKVIRLSAATQEYPKSIVCNVHGVNPKFLEIGLRK--LEQQKLQEQPFTKGAYYIGKMV 241
115452143 239 WSKGYTELLQLLQKHQKELSGLKMELYGSGEDSDEVKASAEKLNLDVRVYPGRDHGDSIFHDYKVFINPSTTDVVCTTTA 318
115451541 239 WSKGYRELLDLLSKYQSKLVGLEVDLYGSGEDSDEVRKSAELLSLAVKVHPGRDHADPLFHDYKVFINPSTTDVVCTTTA 318
22328179  241 WSKGYKELLKLLEKHQKELAELEVDLYGDGEDSEEIKEAARKLDLTVNVYPGRDHADSLFHNYKVFLNPSTTDVVCTTTA 320
242036203 240 WSKGYTELLHLLHKHQMELSVLKMELYGSGEDADEVKASAERLSLDIRVYPGRDHGDSIFHDYKVFINPSTTDVVCTTTA 319
225454079 239 WSKGYKELLKLLHDNQKELTGLEVDLYGNGEDSDQVQGAAKKLELDVRVYPGHDHADPLFHDYKVFLNPSTTDVLCTTTA 318
224130208 242 WSKGYKELIKLLQDNQKELIGLEVDLYGSGEDSDQVQAAAKKLDLVVRVYPGRDHADPVFHDYKVFLNPSTTDVVCTTTA 321
255541500 240 WSKGYKELLKLLDDHQKELTGLEVDLYGSGEDSDQVQEAAKKLELVVRVNPGRDHADPVFHDYKVFLNPSTTDVVCTTTA 319
297810121 242 WSKGYKELLKLLEKHQKELPELEVDLYGDGEDSEEIKAAARKLELTVNVYPGRDHADSLFHNYKVFLNPSTTDVVCTTTA 321
115452143 319 EALAMGKIVICANHPSNEFFKRFPNCHMYNTEKEFVRLTMKALAEEPIPLSEELRHELSWEAATERFVRVADIAPIMSIK 398
115451541 319 EALAMGKIVICANHPSNEFFKQFPNCRTYDSGEEFVQLTLDALAEQPAPLTDMQSHDLSWEAATERFMEAAELNLPISAE 398
22328179  321 EALAMGKIVVCANHISNKFFKQFPNCRTYDDGQGFVRATLKALGEQPSQLTEQQRHELSWEAATQRFIKVSDLNRLSRAD 400
242036203 320 EALAMGKIVICANHPSNDFFKRFPNCHMYSTEKEFVTLTMKALGEEPIPLSDDLRHELSWEAATERFVRVADIAPTMPVG 399
225454079 319 EALAMGKIVVCANHPSNDFFKQFTNCRTYQDSSGFVKETLKALSEEPAQLTDAQMHELSWDAATERFLQAAGLDHVVERK 398
224130208 322 EALAMGKIVVCANHPSNEFFKQFVNCWTYDNSKGFVEATSRALTEEPAELTGAQRHELSWEAATERFLRVADLDQVFARK 401
255541500 320 EALAMGKIVVCANHPSNDFFKQFSNCQTYDNRKGFVEAVCKALAEQPAELTDEERYALSWEAATERFLKVAELDLPSAWK 399
297810121 322 EALAMGKIVVCANHISNEFFKQFPNCRTYDDGKGFVRATVKALGEQPLQLTEQQRHELSWEAATQRFIKACDLSRLSRAE 401
115452143 399 Q-----HSPSPQYFMYISpdELKKNMEEASAFFHNAISGFETARCVFGAIPNTLQPDEQQCKELGWRLQE 463
115451541 399 PrihqtSKVSLPAFMRTR--KLKQSLEDASVYLHQALSGLEVTRRAFGAVPKTLQPDEQLCNDLGLAPAK 466
22328179  401 S-----NLSKRSVFASSSi-SVGKNLEDMSAYIHFLASGFEASRTAFGAIPGSLQPDEELCRDLGLSLNT 464
242036203 400 Q-----QPPASPHFMRISpdNLQKNMEEASAFFHNTISGIETARCVFGAIPNTLQPDEQQCKELGWKLQG 464
225454079 399 P-----TDTPPKKFMSMTm-NLRKNMDDASAYVHHVASGIEASRRVFGAIPGSLQPDEEQRQELGWAFPT 462
224130208 402 P-----AKSLLKNFAST---SLNTRMEDVSAYLHYVALGSETSRRAFGAIPGSLQPDEELCQELGLAIPA 463
255541500 400 V-----ERVPSKNFASTSl-NLRQNIEDASAYVHHVVSGFEVSRRAFGAIPGSLQPDEQQCKELGLAISA 463
297810121 402 S-----NISKKSVFASSSi-SMGKNLEDMSAYIHFLASGFEASRTAFGAIPGSLQPDEELCRDLGLPLNT 465
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap