Conserved Protein Domain Family
PLN02838

?
PLN02838: PLN02838 
3-hydroxyacyl-CoA dehydratase subunit of elongase
Statistics
?
PSSM-Id: 166479
View PSSM: PLN02838
Aligned: 12 rows
Threshold Bit Score: 345.242
Threshold Setting Gi: 168010598
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297596116   1 MAADGSMVRRLYLSIYNWVAFIGWAQVLCYMTLALLDKGHEAVYAAIERPLLFTQTAAILEVLvfpsslplfirenWRLR 80 
115434548   1 MTGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVYAAVERPLQFAQTAAFLEIL-------------HGLV 67 
115434554   5 AAGMASVLRRLYLSVYNWIVFIGWVQVSWSMILALLEKRYEAVYAAVEQHLLFAQTAAIMEIL-------------HSIV 71 
115457488   1 MAGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVYAAVERPLQFAQTAAFLEIL-------------HGLV 67 
22326707    1 MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEIL-------------HGLV 67 
168010598   1 -----MGLARAYLAVYNWVLFAGWSQILYSAVFALYTRGPPAVYEAVEKPLQIWQTAALLEIF-------------NSIV 62 
145334369   1 -------------------------MVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEIL-------------HGLV 42 
225467969   1 -MAFFSLLRRLYLTIYNWVVFFGWAQVLFFALSTLKESGHQHVYRAVERPLQLAQTAAVLEIF-------------HGLV 66 
225467209   1 -MAFFSLLRRLYLTIYNWVVFFGWAQVLFFALSTLKESGHQHVYRAVERPLQLAQTAAVLEIF-------------HGLV 66 
224097190   1 MARILSLLRRLYLTVYNWAVFLGWSQVLFLAVKTLKDSGHEHVYNAVEKPLQLAQTAAVLEIL-------------HGLV 67 
255586032   1 MAGFFSLLRRLYLTIYNWAVFIGW-----------QESGYQHVYNAVERPLFLAQTAAVLEIF-------------HGLV 56 
297811155   1 MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEIL-------------HGLV 67 
297596116  81 GLVRSPVSSTLPQITGRLFITWGILWSFPETQSYIFVTSLLICWCIIEVTRYSFYGMKESFGFTPSWLLWLRYSTFIACF 160
115434548  68 GLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHILVTSLVISWSITEIIRYSFFGMKETFGFAPSWLLWLRYSTFMVLY 147
115434554  72 GLVRSPVSSTLPQITARLFMIWGILRSFPEIHTHIFVTSLLISWCITEVTRYSFNGMKESFGFTPSWLLWLRYSTFIVCF 151
115457488  68 GLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHILVTSLVISWSITEIIRYSFFGMKEAFGFAPSWLLWLRYSTFMVLY 147
22326707   68 GLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLY 147
168010598  63 GITSSPVTATLPQISSRVFITWGVLFSFPQVRDHWLVTSLILSWAVTEVIRYSFFGLKEVFGSPPRFLLWLRYTTFYVLY 142
145334369  43 GLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLY 122
225467969  67 GLVRSPITATLPQIGSRLYVTWGILWSFPEVQTHVLVSSLVISWSITEIIRYSFFGVKELLGFAPAWLLWLRYSTFLLLY 146
225467209  67 GLVRSPITATLPQIGSRLYVTWGILWSFPEVQTHVLVSSLVISWSITEIIRYSFFGVKELLGFAPAWLLWLRYSTFLLLY 146
224097190  68 GLVRSPITATLPQIGSRLYLTWIILYSFPEIRSHFLVTSLVISWSITEIIRYSFFGVKEVLGFAPSWLMWLRYSTFLLLY 147
255586032  57 GLVRSPITATLPQIGSRLYVTWGILYSFPEIRTHFLVSSLVISWSITEIIRYSFFGTKEALGYAPAWLMWLRYSTFLLLY 136
297811155  68 GLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLY 147
297596116 161 PVGVVSEICLAYTVLPFMKASEKYCLRMPNKWNFSFNYFYANVFFMAFYVPVVPYLFHHMIAQRKKALSKAKTT 234
115434548 148 PTGISSEVGLIYIALPYMKATEKYCLRMPNKWNFSFDFSYASILSLAVYVPGSPHMFTYMLAQRKKALAKAKAA 221
115434554 152 PIGMVSEVGLVYIVVPFMKASEKYCLRMPNKWNFSIKYFYASVFFMALYAPVYPHLFHYLIVQRKKALAKSKTT 225
115457488 148 PTGISSEVGLIYIALPYMKASEKYCLRMPNKWNFSFDFFYASILSLAIYVPGSPHMFTYMLAQRKKALAKAKAA 221
22326707  148 PTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE 221
168010598 143 PTGICSEAGLIFVALPFMKETGLYSLRMPNKMNFGFDYYYASILAILAYIPGSPGMYSHMIRQRKKALGAKPKS 216
145334369 123 PTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE 196
225467969 147 PTGITSEVGLIYIALPYIKESAKYCLRMPNKWNFSFDYFYAALLVIAFYVPGSPHMYQYMLGQRKRALSKSKRE 220
225467209 147 PTGITSEVGLIYIALPYIKESAKYCLRMPNKWNFSFDYFYAALLVIAFYVPGSPHMY----------------- 203
224097190 148 PTGISSEVGLVYFALPYIKGSEKYCLRMPNKWNFSFDNFYAAILVLGIYIPGSPHMYSYMLGQRKKALSKSKRE 221
255586032 137 PTGISSEVGLIYFALPYIKKSEKYCIRMPNTWNFSFDNFYAAILVLGIYVPGSPHMYSYMLGQRKKALSKSKRE 210
297811155 148 PTGITSEVGLIYLALPHIKTSEMYSVRMPNTLNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap