Conserved Protein Domain Family
PLN02817

?
PLN02817: PLN02817 
glutathione dehydrogenase (ascorbate)
Statistics
?
PSSM-Id: 166458
View PSSM: PLN02817
Aligned: 4 rows
Threshold Bit Score: 464.466
Threshold Setting Gi: 224065178
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18418055    3 SLRFQPSTTAGVLSASVSRAGFIKRCGSTK---------PGRVGRFVTMATAASPLEICVKASITTPNKLGDCPFCQKVL 73 
115467258   8 TTSATTATSGGSSSATALLATTFRRGGRRLlllpatrgsAPRRAALLTARASAEPLEVCAKASLTVPDRLGDCPFTQRVL 87 
224065178   1 ----------------------------------------------MSATSVSEPLEICVKASLTVPDKLGDCPFCQRVL 34 
225451397   1 MSSVRIPPTASAVSSTIKHLGYNPRFFTSHggakgvkrvGGERRKY--SITMSSPLEVCVKASVIIPNKLGDCPFSQRIL 78 
18418055   74 LTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPVVKFDEKWVPDSDVITQALEEKYPEPPLATPPEKASVGSKIFSTFV 153
115467258  88 LTIEEKHLPYDIKLVDLANKPDWFLKISPEGKVPIVKLEEQWVADSDVITQAIEEKYPEPSLATPPEKASVGSKIFSTFI 167
224065178  35 LTLEEKNLPYDMKFVDLGNKPEWFLKLNPDGKVPVIKFEENWVSDSDVITQALEEKFPDPPLAIPPEKASVGSKIFSTFI 114
225451397  79 LTLEEKHLPYEMKLVDLTNKPEWFLKISPGGTVPVMKLDEKWIADSDVIAQSLEEKYPDPPLGTPPEKASVGSKIFPAFI 158
18418055  154 GFLKSKDSGDGTEQVLLDELTTFNDYIKDNGPFINGEKISAADLSLAPKLYHMKIALGHYKNWSVPDSLPFVKSYMENVF 233
115467258 168 GFLKSKDPNDGTEQALLSELTSFDSYLKDNGPFINGETISAADLSLAPKLYHMEIALGHYKNWSVPDSLSHVKKYMKTIF 247
224065178 115 GFLKSKDPGDGTEQALLDELSAFNDHIKENGPFINGEKVSAADLALGPKLYHLEIALGHYKNWSVPESLPYVKSYLKEIF 194
225451397 159 GFLKSKDPSDGTEQTLLNELASFDDYIKENGPFINGKDISAVDLSLGPKLYHLEIALGHYKKWTVPDSLPFVKSYMKNIF 238
18418055  234 SRESFTNTRAETEDVIAGWRPKVMG 258
115467258 248 SMDSFVKTIALQEDVIAGWRPKVMG 272
224065178 195 SRDSFVNTRALPEDVIAGWRPKVMG 219
225451397 239 SMESFVKTRGLPEDVIAGWRPKVMS 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap