Conserved Protein Domain Family
PLN02808

?
PLN02808: PLN02808 
alpha-galactosidase
Statistics
?
PSSM-Id: 166449
View PSSM: PLN02808
Aligned: 8 rows
Threshold Bit Score: 754.875
Threshold Setting Gi: 79327298
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255569397  28 LFVLDANMATAAARPFMEIRRNLLGNGLGLTPPMGWNSWNHFQCNIEETLIRETADAMVSSGLAALGYQYINLDDCWAEL 107
18415796    9 RFIAFTLTITLTQIADGFQSRMLMNNGLALSPQMGWNSWNHFQCNINETLIKQTADAMVSSGLSAIGYKYINIDDCWGEL 88 
79327298    1 ------------------MSRMLMNNGLALSPQMGWNSWNHFQCNINETLIKQTADAMVSSGLSAIGYKYINIDDCWGEL 62 
224108391   1 MVTVSHAARVRELGEAEAIRRNLLDNGLGHTPQMGWNSYNHFPCKLNEELIRETADAMVSSGMAALGYKYINLDDCWAEL 80 
224118658   1 -------------------MRGLSANGLGLAPPMGWNSWNHFHCNIEEKLIRDTADAMVSSGLAALGYEHVNLDDCWAEL 61 
225463809  24 AICGGAPGLLNSESTETTSWRNLLANGLACTPQMGWNSWNHFGCKIDENLIKETADAMVSSGLAALGYHYVNLDDCWGEK 103
225463811   1 ------------------MKRKLLDNGPGQTPQMGWNSYNHFPCKLSEELIHQTADAMVSTGLSALGYKYINLDDCWAEL 62 
297810941   7 FLRFITFTLTLTQIVDGFQSRMLMHNGLALSPQMGWNSWNHFQCNINETLIKQTADAMVSSGLSAIGYKYINIDDCWGEL 86 
255569397 108 QRDSQGNLVPKVSTFPSGIKALADYIHGKGLKLGIYSDAGTQTCSRTMPGSFGYEEQDAKTFASWGIDYLKYDNCNNDGT 187
18415796   89 KRDSQGSLVAKASTFPSGIKALSDYVHSKGLKLGIYSDAGTLTCSQTMPGSLGHEEQDAKTFASWGIDYLKYDNCENTGT 168
79327298   63 KRDSQGSLVAKASTFPSGIKALSDYVHSKGLKLGIYSDAGTLTCSQTMPGSLGHEEQDAKTFASWGIDYLKYDNCENTGT 142
224108391  81 KRDSKGNLVPKKSIFPSGMKALADYVHSKGLKIGIYGDAGTLTCAKTMPGSLGYEEQDAKTFASWGIDYLKYDNCHNNGV 160
224118658  62 NRDSEGNLVPKASTFPSGIKALADYIHGKGLKLGIYSDAGSQTCSGTMPGSLGHEEQDAKTFASWGVDYLKYDNCNNDGT 141
225463809 104 NRDSDGNLVAKHSTFPSGIKALADYVHKKGLKLGIYSDAGTQTCSKTMPGSLGHEEKDAKTFASWEVDYLKYDNCENTGI 183
225463811  63 NRDSKGNLVPKASIFPSGMKALADYVHSKGLKIGIYADAGTLTCSKTMPGSLNYEEQDANTFASWGIDYLKYDNCHNNGL 142
297810941  87 KRDSQGSLVAKASTFPSGIKALSDYVHSKGLKLGIYSDAGTLTCSQTMPGSLGHEEQDAKTFASWGIDYLKYDNCENTGT 166
255569397 188 SPKLRYPIMSKALLNSGRPIFFSLCEWGQEDPATWAPSIGNSWRTTGDISDNWESMISRAGENDKWASYARPGGWNDPDM 267
18415796  169 SPRERYPKMSKALLNSGRSIFFSLCEWGQEDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDM 248
79327298  143 SPRERYPKMSKALLNSGRSIFFSLCEWGQEDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDM 222
224108391 161 SPQERYSKMSKALLSTGRPIFFSLCEWGQDNPATWAAGIGNSWRTTGDIKDTWDSMISRADQNDDWASYAGPGGWNDPDM 240
224118658 142 SPKERYPVMSKALLNSGRPIFFSLCEWGQEDPATWASNVGNSWRTTGDISDNWDSMTSRADQNDQWASYAAPGGWNDPDM 221
225463809 184 RPQERYIKMSKALLNSGRSIFFSLCEWGQEDPATWAKDVGNSWRTTGDIEDNWDSMTSRADENDKWAAHAGPGGWNDPDM 263
225463811 143 SPQERYSNMSKALLNTGRPIFYSLCEWGQDNPATWASSIGNSWRTTGDIKDTWESMTSHADLNDVWASYAGPGGWNDPDM 222
297810941 167 SPRERYPKMSKALLNSGRSIFFSLCEWGQEDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDM 246
255569397 268 LEVGNGGMTTEEYRSHFSIWALAKAPLLIGCDIRSMSNETYEILSNKEVIAVNQDKLGVQGKKVKNDGDLEVWAGPLSNR 347
18415796  249 LEVGNGGMTKEEYMSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVKKEGDLEVWAGPLSKK 328
79327298  223 LEVGNGGMTKEEYMSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVKKEGDLEVWAGPLSKK 302
224108391 241 LEVGNGGMSTEEYRSHFSIWALMKAPLLLGCDIRSMDNDTFELLSNKEVIAVNQDKLGLQGKKVKKTGDLEVWAGPLSGK 320
224118658 222 LEVGNGGMTTEEYRSHFSIWALAKAPLLIGCDVRTMSDETIEILSNREVIAVNQDKLGVQGKKVKNNGDLEVWAGPLSNN 301
225463809 264 LEVGNGGMRKEEYQSHFSIWALAKAPLLIGCDVRSMDNSTFELLSNKEVIAVNQDELGVQGRKVKKDGNLEVWAGPLSDN 343
225463811 223 LEVGNGGMSTEEYRSHFSIWALAKAPLLIGCDIRSMDNETFELLSNKEVIEVNQDKLGAQGKKVKKTGDLEVWSGPLSDN 302
297810941 247 LEVGNGGMTKEEYRSHFSIWALAKAPLLIGCDLRSMDNVTFELLSNKEVIAVNQDKLGIQGKKIKKDGDLEVWAGPLSKK 326
255569397 348 KVAIVLWNRGSSRATVTAYWSDIGLnNSTTMVHARDLWAHSTQSSVKGHISADLDSHACKMYVLTPL 414
18415796  329 RVAVILWNRGSASANITARWAEIGL-NSSDIVNARDLWEHSTYSCVKKQLSALVEPHACKMYTLTRR 394
79327298  303 RVAVILWNRGSASANITARWAEIGL-NSSDIVNARDLWEHSTYSCVKKQLSALVEPHACKMYTLTRR 368
224108391 321 RIAAVLWNRGSSRASITADFKDIGL-KSSAVVNARDLWAHSTMTSVRHQLTVTVESHACKMFVLTPQ 386
224118658 302 KIAVVLWNRGSSRATVTAYWSDIGL-DPTTTVNARDLWAHSNQPSVKGQISADLDSHACKMYVLTPQ 367
225463809 344 KVAVVLWNRGSSQANMTAHWSDIGL-SPSAVVDARDLWAHSTQSSVQGQLWAQVDSHACKMYILTPK 409
225463811 303 RVAVVLWNRESSEATIIADWSDIGL-NSSAVVDARDLWTHSTIYSIRHQLKATVEAHACKMYALTPH 368
297810941 327 RVAVILWNRGSVSAKITARWADIGL-SSSDIVNARDLWEHSTHSRVKNQLSALVEPHACKMYTLTRR 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap