Conserved Protein Domain Family
PLN02780

?
PLN02780: PLN02780 
ketoreductase/ oxidoreductase
Statistics
?
PSSM-Id: 166421
View PSSM: PLN02780
Aligned: 6 rows
Threshold Bit Score: 611.485
Threshold Setting Gi: 297838517
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225424552   1 MELCfmEKLQTQPLWVIVLFAVGCLSVLKSFLAILNGVYVCFLRPGKNLKKYGSWALVTAPTDGIGKGFAFELARKGLNL 80 
18408847    1 MEIC--TYFKSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITGPTDGIGKAFAFQLAQKGLNL 78 
224100105   1 MGLRfiDQLKDQPFWLLLLFTLGSLSLLKFLSATLKWVYVSFLRPAKNLKKYGSWALVTGPTDGIGKGFAFQLARKGLNL 80 
224107711   1 MSLCfvDELKSQPSWLLVLFTLGSLSFLKFLFASLKWVYVSFLRPAKNLKKYGSWALVTGPTDGIGKGFAFQLARKGLNL 80 
255547948   1 MELCfvDKLKSQPLWFLVLFSLGSLSLLRCFFTILNWVYVNFLRPAKNLKKYGSWALVTGPTDGIGKGFAFQLARKGLNL 80 
297838517   1 MEIC--TYFKSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPGKNLRRYGSWAIITGPTDGIGKAFAFQLAQKGLNL 78 
225424552  81 VLVGRNPDKLKDVSDAIQSKYGKTQIKAVVVDFAGDISEGVLKIREAILGLDVGVLINNVGVSYPYARFFHEVDDELLKN 160
18408847   79 ILVARNPDKLKDVSDSIRSKYSQTQILTVVMDFSGDIDEGVKRIKESIEGLDVGILINNAGMSYPYAKYFHEVDEELINN 158
224100105  81 VLVGRNPDKLKDVSRSIQSRYSNVQIKNVVVDFSGDIDEGVQKIKETIEGLDVGVLINNVGVSYPCARFFHEVDEGLLKN 160
224107711  81 ILVGRNPDKLKDVSTSIQSKYSNVQIKNVVVDFSGDIDEGVQKIKETVEGLDVGILINNVGVSYPYARFFHEVDEELLKH 160
255547948  81 VLVARNPDKLKDVSDSILSKYGKVQIKTVVVDFSGDIDEGVKRIKDTVEGLDVGVLINNVGVSYPYARFFHEVDEELLKN 160
297838517  79 ILVARNPDKLKDVSESIRSKYSQTQILTVVMDFSGDIDEGVKRIKETIEGLDVGILINNAGMSYPYAKYFHEVDEELLNN 158
225424552 161 LIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYAVYAATKAYIDQFSRCLYVEYKNSGIDVQCQVPLY 240
18408847  159 LIKINVEGTTKVTQAVLPNMLKRKKGAIINMGSGAAALIPSYPFYSVYAGAKTYVDQFTKCLHVEYKKSGIDVQCQVPLY 238
224100105 161 LIKVNVEGTTKVTQAVLHGMLKKKKGAIVNIGSGAAIVIPSDPLYAVYAATKAYIDQFSRCLYVEYKKSGIDVQCQVPLY 240
224107711 161 LIRVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYAVYAATKAYIDQFSRCLYVEYKKSGIDVQCQVPLY 240
255547948 161 LIKVNVEGTTKVTHAVLPGMLKRKKGAIINIGSGAAIVIPSDPLYAVYAATKAYIDQFSRCLYVEYKKSGIDVQCQVPLY 240
297838517 159 LIKINVEGTTKVTQAVLPNMLQRKKGAIINMGSGAAALIPSYPFYSVYAGAKTYVDQFTKCLHVEYKKSGIDVQCQVPLY 238
225424552 241 VATKMASIRRSSFLVPSSDGYARAAMRWIGYEPRCTPYWPHVLIWGLACQLPECAIDVWRLGFNLKIRKRGQLKGSRKQE 320
18408847  239 VATKMTKIRRASFLVASPEGYAKAALRFVGYEAQCTPYWPHALMGAVVSALPESVFESFNIKRCLQIRKKGLQKDSMKKE 318
224100105 241 VATKMASIRRSSFWVPSSDGYARAGLRAIGYEPRCTPYWPHSLLWGLIQLLPESIVDFWRLSFCLAIRKKGHLKDSRKME 320
224107711 241 VATKMASIKRSSFWVPSSDSYARAGLRAIGYEPRCTPYWPHSLLWGLIQLLPESAVDSWRLGFCLRIRKRGQLKDSRKNE 320
255547948 241 VATKMASIRRSSFFVPSTDDYARAGLRWVGYEPRCTPYWPHSLIWGLISIVPEFAVDAWRYKFNLGIRKRGQQKDARKKE 320
297838517 239 VATKMTKIRRASFLVASPEGYAKAALRFVGYEAQCTPYWPHALMGAVVSALPESVFESFNIKRCLQIRKKGLQKDSMKKE 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap