Conserved Protein Domain Family
PLN02756

?
PLN02756: PLN02756 
S-methyl-5-thioribose kinase
Statistics
?
PSSM-Id: 166397
View PSSM: PLN02756
Aligned: 8 rows
Threshold Bit Score: 854.161
Threshold Setting Gi: 297847308
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18402794    1 MSFEEFTPLNEKSLVDYIKSTPALSSKIGADKsdDDLVIKEVGDGNLNFVFIVVGSSGSLVIKQALPYIRCIGESWPMTK 80 
115461214  11 QQQQGFRPLDEASLVAYIKATPALAARLGGSL--DALTIKEVGDGNLNFVYIVLSDAGSVVIKQALPYIRCVGDSWPMTR 88 
224056200   1 MAFTEFRPLAEKSLIEYIKATSVLSDKIGNNF--GDLKIKEVGDGNLNFVYIVASPSGSFVIKQALPYIRCIGESWPMTK 78 
224103675   1 MVFTEFRPLDEKYLVEYIKATPALSDKIGNNF--DDLKIKEVGDGNLNFVYIVVSPAGSFVIKQAIPYIRCIGESWPMTK 78 
225429289   1 MASSGFRPLDDKSLIEYIKATPALSSKLANQL--DGLQIKEVGDGNLNFVYIVISSSGSFVIKQALPYIRCIGESWPMTK 78 
225429291   1 MTSSGFRPLDDKSLVEYIKATPALFSKLANQL--HGLQIKEVGDGNLNFVYVVISSAGSFVIKQALPYIRSIGESWPMTK 78 
255555259   1 MAFSEFRPLDEKSLIEYIRGTPVLANKIGDKF--DDLKIKEVGDGNLNFVYIVVSSDGSFVIKQALPYIRCIGESWPMTK 78 
297847308   1 MSFEEFTPLNEKSLVDYIKATPALSSKIGADKs-DDLVIKEVGDGNLNFVFIVVGSSGSLVIKQALPYIRCIGESWPMAK 79 
18402794   81 ERAYFEATTLRKHGNLSPDHVPEVYHFDRTMALIGMRYLEPPHIILRKGLIAGIEYPFLADHMSDYMAKTLFFTSLLYHD 160
115461214  89 ERAYFEASALQKHRGLCPDHVPEVYHFDRAMSLIGMRYIEPPHIILRKGLIAGVEYPLLAEHMADYMAKTLFFTSLLYNS 168
224056200  79 ERAYFEALALREHGRLCPENVPEVYHFDRTMSVIAMRYLEPPHIILRKGLIAGIEYPLLAEHMSDYIAKTLYYTSLLYRT 158
224103675  79 ERAYFEALTLREHGRWSPENVPEVYHFDRIMSVIGMRYLEPPHIILRKGLVAGIEYPLLAEHISDYMAKTLYHTSLLFHT 158
225429289  79 ERAYFEATALREQRRWCSDHVPEVYHFDREMALIGMRYLEPPHIILRKGLIAGIEYPLLAEHMSEFMARTLFFTSLLYHD 158
225429291  79 DRAYFEATALREQRRWCSNHVPEVYHFDREMAVIGMRYLEPPHIILRKGLIAGIEYPLLAEHMSEFMARTLFFTSLLYHD 158
255555259  79 ERAYFEARTLKEHGRLCPEHVPDVYHFDHTMCLIGMRYLEPPHIILRKGLIGGHEYPHLAEHMSDYMAKTLFYTSLLYLT 158
297847308  80 ERAYFEATTLRKHGNLSPDHVPQVYHFDRTMALIGMRYLEPPHIILRKGLIAGIEYPFLADHMSDYMAKTLFFTSLLYHD 159
18402794  161 TTEHRRAVTEFCGNVELCRLTEQVVFSDPYRVSTFNRWTSPYLDDDAKAVREDSALKLEIAELKSMFCERAQALIHGDLH 240
115461214 169 TTDHKKGVAQYCDNVEMCRLTEQVVFSDPYMLAKYNRCTSPFLDNDAAAVREDAELKLEIAELKSMFIERAQALLHGDLH 248
224056200 159 TTEHKRDVAEFCGNVELSRLTEQVVFSDPYKISQYNRWTSPYLDRDAEAVREDNILKLEVAELKSMFCERAQALVHGDLH 238
224103675 159 TTEHKHNVAEFCGNVELCRLTEQVVFSDPYKVSEYNRWTSPYLDRDAEAVREDNILKLEVAELKSKFCERAQALVHGDLH 238
225429289 159 TTEHKRAVAEFCGNVELCRLTEQVVFSDPYKVSQYNRWTSPYLDRDAEAVREDNILKLEVAELKSMFCERSQALVHGDLH 238
225429291 159 TTEHKRAVAEFCGNVELCRHTGQVVFSDPYKVSQYNWWTSPYLDRDAEAVREDNILKLEVAELKSMFCERSQALVHGDLH 238
255555259 159 TTEHKRAVAEFCGNVELCRLTEQVVFSDPYKVSQYNHWTSPYLDHDAEAVREDNILKLEIAELKSKFCERGQALIHGDLH 238
297847308 160 TTEHRRAVTEFCGNVELCRLTEQVVFSDPYRVSTFNRWTSPYLDDDAKAVREDSALKLEIAELKSMFCERAQALIHGDLH 239
18402794  241 TGSVMVTQDSTQVIDPEFSFYGPMGFDIGAYLGNLILAFFAQDGHATQENDRKEYKQWILRTIEQTWNLFNKRFIALWDQ 320
115461214 249 TGSIMVTPDSTQVIDPEFAFYGPMGYDIGAFLGNLILAYFSQDGHADQANDRKAYKKWILKTIEDSWNLFHKKFVELWNK 328
224056200 239 TGSVMVTHDSTQVIDPEFAFYGPMGFDIGAFIGNLILAFYAQDGHADQMNDRKRYKEWILRTIRETWSLFYKKFTALWDE 318
224103675 239 TGSVMVTHESTQVIDPEFAFYGPMGFDIGAFIGNLILAFFAQDGHADQGNDRKTYKEWILRTIKETWSLFYKKFTALWDE 318
225429289 239 TGSVMVTPDSTQVIDPEFGFYGPMGFDIGAFLGNLILAYFAQDGHADQVNDRKTYKEWILKAIEQTWNLFHKKFTALWDE 318
225429291 239 TGSVMVTPDSTQVIDPEFGFYGPMGFDIGAFLGNLILAYFAQDGHDDQVNDRKTYKKWILKTIEQTWNFFHKKFTALWNE 318
255555259 239 TGSVMVTPSSTQVIDPEFSFYGPMGFDIGAFIGNLILAYFAQAGHADSANDRKSYKEWILKIIENTWNLFDKKFIALWDE 318
297847308 240 TGSVMVTQDSTQVIDPEFSFIGPMGFDIGAYLGNLILAFFAQDGHAAQGNDRKEYKQWILRSIEQTWDLFNKRFIALWDQ 319
18402794  321 NKDGPGEAYLADIYNNTEVLKFVQENYMRNLLHDSLGFGAAKMIRRIVGVAHVEDFESIEEDKRRAICERSALEFAKMLL 400
115461214 329 HKDGNGEAYLPPIYNSSELLCLAQKKYMTSLFHDSLGFGSAKMIRRIVGIAHVEDFESIEDASKRASCERRALNCAKAIL 408
224056200 319 HKDGSGEAYLPEIYNNPELRLLVQRKFMQDLLHDTLGFGAAKMIRRIVGVAHVEDFESITDASKRAKCEQQALDLAKMVL 398
224103675 319 HKDGSGEAYLPGIYNNPELHQLVQRKFMQDLFHDTLGFGAAKMIRRIVGVAHVEDFESIPDASKRAQCERPALDLAKMLI 398
225429289 319 HRNGSGEAYLPEIYNNSELQLLTQKKYMQGLLHDTLGFGAAKMIRRIVGVAHVEDFESIVDASKRANCERQALVFAKMLL 398
225429291 319 HRNGSGEAYLPEIYNNPELQLLTQKKYMQDLLHDTLGFGAAKMIRRIVGVAHVEDFESIVDASKRANCERQALVFAKMLL 398
255555259 319 HKDGPGEAYLPEIYNKPEVRQLVQRKFMRDLFHDTLGFGAAKMIRRIVGVAHVEDFESIKDASKRAECERKALDFAKMLL 398
297847308 320 NKDGPGEAYLADIYNNPGVLQLVQENYMRNLLLDSLGFGAAKMIRRIVGVAHVEDFESIEEDKRRAVCERSALEFAKMLL 399
18402794  401 KERRKFKSIGEVVSAIQQQS 420
115461214 409 KGRRQFESIGQVIVHVQSFD 428
224056200 399 KERKKFQSIDEVVLAIQQVQ 418
224103675 399 KERRKLQSIDEVVSAIQQLQ 418
225429289 399 KERRKFQAITEVVLAVQQEQ 418
225429291 399 KERRKFQAITEVVSAIQQEQ 418
255555259 399 KNRRDFDSIDGVVSAMQPLD 418
297847308 400 KERRKFTCIGEVVSAIQNQS 419
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap