Conserved Protein Domain Family
PLN02722

?
PLN02722: PLN02722 
indole-3-acetamide amidohydrolase
Statistics
?
PSSM-Id: 166363
View PSSM: PLN02722
Aligned: 5 rows
Threshold Bit Score: 769.44
Threshold Setting Gi: 297843692
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18390964    1 MATNNDFGAFIEKVTISPTSTSSSPPsLQGLTFAIKDIFDVEGRVTGFGNPDWLRTHSAATSTAPVVSSLLEAGATALGI 80 
225450991   1 MAKASNYGAFMERFILQPSSSSHELP-LNGLTFAVKDIFDVDGYVTGFGNPDWARTHQAAMLTAPSVLAVLKGGATCVGK 79 
224125294   1 MERDPDYGAFMDKFVLEPTSSAHDQP-LHGLTFAVKDM---EGYVTGFGHPDWARTHSAATSTAPAVLAVLRGGATCVGK 76 
255542602  73 MAISPDYGAFMEKFVLKPSSSSDQLP-LHSLTFAVKDIFDVDGYVTGFGNPDWARTHSAATATAPAVLAVLRGGATCVGK 151
297843692   1 MATNNDFGAFIEKVTISPTSTSSLPPsLQGLTFAIKDIFDVEGRVTGFGNPDWLRTHTAATSTAPVVSSLLEAGATALGI 80 
18390964   81 TIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSAVAVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHGAVSTV 160
225450991  80 TVMDEMAYSINGENKHYGTPTNPQAPDRVPGGSSSGSAVAVGAMLVDFSLGTDTGGSVRVPASYCGIFGIRPSHGVVSTT 159
224125294  77 TIMDEMAYSINGENIHYGTPINPCAPDRVPGGSSSGSAVAVGAKIVDFSLGTDTGGSVRVPASYCGILGFRPSHDAVPSA 156
255542602 152 VIMDEMAYSINGENAHYGTPTNPSAPDRVPGGSSSGSAVAVGAKLVDFSLGSDTGGSVRVPASYCGILGFRPSHGVVSVS 231
297843692  81 TIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSAVVVAARLVDFSIGTDTGGSVRVPASYCGIFGFRPSHGAVSTV 160
18390964  161 GLTPMAQSFDTVGWFARDTATLKRVGCVLLQQHHLNPIEPSQLIIADDCFKLCSVPHDLLVQPLVGSVEKSFG--GNTVV 238
225450991 160 GVIPMAQSFDTVGWFARDPEILNRVGHVLLPFPDVNPVKPSQIIIPEDCFRLLSIPIDRVTQVLIKSVEKLFGsnAGDIV 239
224125294 157 GVIPMAQSFDTVGWFARDPVILSRVGHILLQSPVMDPIKPSQVIIAEDCFQLSNIPNDRLGQVLVKSVEKIYG---GHIL 233
255542602 232 GVIPMAQSFDTVGWFSRNPVILKHVGRLLLQLPDVDRTKPNQIFIAEDCFQLSSIPKKRVSQVLVKSVEKLFG---GDIV 308
297843692 161 GVTPMAQSFDTVGWFARDTATLKRVGCVLLQQDHLNPIEPSQLIIADDCFKLCSVPHDLLVQPLVGSVEKSFG--GNTVV 238
18390964  239 KKVNLGEYIGQNVPSLKHFMTSDdvTTQQEFCIPSLMALSSSMRLLQRHEFKINHGAWISSVKPEFGPGISERIEEAIRT 318
225450991 240 KHVSLGDYVEDKVTSLKPFMSKE--NQTQEYNIPSLAALSTAMRLLQRYEFKNNHGEWVREVQPDLGPGIRERVWEALGT 317
224125294 234 KHTVLGDYVKEKVPSLKHFMSNE--IKELEHNIPSLAALSNAMRSLERYEFKDNHGEWITAVKPELGPAISERVWEAVRT 311
255542602 309 KHVNLGDYVEDKVPSLRHFMSKE--IKEQEYNIAPLAALSSAMRMLQRYEFKTNHGEWVTTVKPDFGPGLKERIWEAVRS 386
297843692 239 KEVNLGEYIEQNVPSLKHFMTSDdvTTQQELCIPSLMALSSSMRLLQRHEFKINHGAWISLVKPEFGPGISARIEEAIRT 318
18390964  319 SDEKIDHCRSVKSELITALSTLLGEKGVLVIPTVPGPPPHLQANVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENL 398
225450991 318 TDEKIDVCQSLKTEFRSALTDLLGDSGVLVLPTVPGPPPKLQTDPTTLESFRARAFSLLSIAGVSGFCQVSIPLGLYDNL 397
224125294 312 TGENVDACHSVKTELHAALATLLQDFGILAIPTVSGLPPKLQADPTTLKIFRAKAFGLLSIAGVSGFCQVSIPLGMYDNL 391
255542602 387 TEENIDAFQSVRTELRAALTNLLEEFGIIAIPTVPGVPPKLNTDPTTLEIFRAKAFSLLSITGVSGFCQVSIPLGMHDGL 466
297843692 319 SEEKIDLCRSVKSELITALSTLLGEKGVLVIPTVPGPPPHLQANVAALESFRSRAFSLLSIAGVSGFCQVSIPLGLHENL 398
18390964  399 PVSVSLVAKYGSDGFLLSLVDSLAAFI 425
225450991 398 PVAVSLLAKHGSDGFLLNLVQTLYGSI 424
224125294 392 PVSVSLLAKQGSDAFLLNVVESLYGTL 418
255542602 467 PVSISLLAKHGSDVFLLNVVETLYDTL 493
297843692 399 PVSVSLVAKYGSDGFLLSLVDSLAAFI 425
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap