Conserved Protein Domain Family
PLN02704

?
PLN02704: PLN02704 
flavonol synthase
Statistics
?
PSSM-Id: 166345
View PSSM: PLN02704
Aligned: 12 rows
Threshold Bit Score: 633.745
Threshold Setting Gi: 297806939
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15242339    1 MEVERVQDISSSSLLTEAIPLEFIRSEKEQPAITTFRGPTPAIPVVDLSDPDEESVRRAVVKASEEWGLFQVVNHGIPTE 80 
225459487   9 TDIERVQAIAFSSLSEGTIPPEFIRSEKEEPAITTFHGYVPQVPTIDFSDPDEANLTRLIAVASMEWGIFQIVNHGIPFH 88 
225459489   1 MAVERVQTIAFSSILVDTIPPEFIRSEKEQPALTTCLGCIPQVPTIDFSDPDEGNLTRLIAEASSEWAMFQIVNHGIPSE 80 
225459491   1 MDMERVQAIAFSFMTEGRIPPEFIRSEKEQPAITTLHGYDPQIPTIDFSDPDEDSLTRLIAEASRDWGMFQIVNHGIPTH 80 
225459493   1 MELKTVQAIAFSSMSAGIIPPEFIRSEKEQPAITTFHGYIPQVPTIDLSDPDEEKLTRLIVEASSEWGMFQIVNHGIPSD 80 
224122686   1 MEFDRVQTIASLSFDKEAIPEEFIMPEKEQPAITTFRGLAPEIPAIDLSDPDQEKLVGLIADASKEWGIFQVINHGIPSD 80 
224122694   1 MEFDRVQTIASLSFDKEAIPEEFIRPEKEQPAITTFRGLAPEIPAIDLSDPDQEKLVGLIADASKEWGIFQVINHGIPSD 80 
224145588   1 MEFDRVQAIASLSFDKETIPEEFIWPEKEQPATTTFDGRVPEIPTIDLNDPNPENLVRLIADASKEWGIFQVVNHGIPSD 80 
224063126   1 MEAERVQNIA--STFEDTIPEAFIRSEHEQPAITTVHGVNLDVPVIDVSDPDEEKITRLIADASREWGMFQIVNHGIPSE 78 
255545428   1 METQRVQGIA--SLSKDTIPEAFIRSENEQPATTTVHGVKLEVPVINLNDPDQEKVKRLIVEASKEWGMFQIIDHGIPSE 78 
255545424   3 TESERVQRIA--SATQDTIPEDFIRSDHEQPALTTVYGVDIGVPTIDISDPDQEKVNRLIVEASEEWGMFQIINHGIPGD 80 
297806939   1 MEVERVQDISSSSLLTEAIPLEFIRSEKEQPAITTFRGPTPAIPVVDLSDPDEESVRRAVVKASEEWGLFQVVNHGIPTE 80 
15242339   81 LIRRLQDVGRKFFELPSSEKESVAKPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPKNPPEYREVNE 160
225459487  89 VITSLQKVGREFFELSQEEKELYAKPPDSKSIEGYGTKLQKEVEGKKAWVDHLFHKVWPPSAINYHFWPKNPPSYRDANE 168
225459489  81 VITNLQKAGKEFFELPQEEKELYAKPPDSKSIEGYGSKLQKEVEGKKAWVDHLFHNIWPPSAINYQYWPKNPPSYRAVNE 160
225459491  81 VINNLQKVGEDFFALPQVEKELYAKPPDSKSIEGYGTRLQKEEEGKRAWVDHLFHKIWPPSAINYQFWPKNPPSYRDANE 160
225459493  81 VISNLQKVGKEFFELPQEEKELYAKSPDSKSIQGYGSKLQKEVEGKKAWVDHLFHNIWPPPAIDYQFWPKKPPTYRAANE 160
224122686  81 LIAELQGAGKKFFELPQEEKEVCARPRDSESIEGYGSKLLNDPQEKKTWVDHLFHRIWPPPSINYQFWPENPPSYREVNK 160
224122694  81 VIAELQGAGKKFFELPQEEKEVCARPRDSKSIEGYDSKLQKDPQEKKSWVDHLFHRIWPPPSINYQFWPENPPSYREVTK 160
224145588  81 LIAKLQDVGKKFFELPQEEKEVYAKPHDSKSIEGYGSKLQNNPQVKKSWVDHLFHIIWPPSSINYQFWPNNPPSYREVNE 160
224063126  79 VISKLQSVGRAFFELPQVEKELYAKPPGAKSIEGYGTFLQKEVEGKKGWVDHLFHRIWPPPAINYRFWPKNPPLYREANE 158
255545428  79 IISKLQSVGKEFFELPQQEKEVYAKKPGGK--EGYGTFLQKEMEGKKGWVDHLFHNIWPPSAINYQFWPKTPPCYRETNE 156
255545424  81 LISKLQSVGKEFFELPQEEKEVYAKKPGRK--EGYGTFLQKEMEGKKAWVDHLFHKIWPPSAINYEFWPKIPPSYREVTE 158
297806939  81 LIRRLQDVGRKFFELPSSEKESVAKPEDSQDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPKNPPEYREVNE 160
15242339  161 EYAVHVKKLSETLLGILSDGLGLKRDALKEGLGGEMAEYMMKINYYPPCPRPDLALGVPAHTDLSGITLLVPNEVPGLQV 240
225459487 169 EYTKCLRGVADRLFSRLSLGLGLDEDELKKSVGGDELTYLLKINYYPPCPRPDLALGVVAHTDMSSITMLVPNEVQGLQV 248
225459489 161 EYCKWVQPVGHRLLSLLSLGLGLEKNELKENVGGDELKYLLKINYYPPCPRPDLALGVVAHTDMSSITILVPNEVQGLQV 240
225459491 161 VYAKCLRGVADKLFSRLSVGLGLGEKELRESVGGDELTYLLKINYYPPCPRPDLALGVVAHTDMSAITILVPNHVQGLQL 240
225459493 161 EYAKWLQGVADKLFGRLSLGLGLGEGTLKESVGGDELLYLLKINYYPPCPRPDLALGVVAHTDMSAITILIPNEVQGLQV 240
224122686 161 EYAKYMRDVVDKLFTTLSLGLGLEGHVLKEAAGGEQIEYMLKINYYPPCPRPDLTLGVEAHTDLSAITILVPNEVPGLQI 240
224122694 161 EYAKYMRDVVDKLFTTLSLGLGLEGHVLKEAAGGEQIEYMLKINYYPPCPRPDLTLGVVAHTDLSAITILVPNEVPGLQI 240
224145588 161 EYAKYMREVTDKLFTALSLGLGLEGHALKEGAGGEEIEYMLKINYYPPCPRPDLTLGVAAHTDLSALTILVPNEVPGLQI 240
224063126 159 EYVKYLHGVVDKLFKSLSLDLGLEEHELKEAVGGDEMTYLLKINYYPPCPRPDLALGVVAHTDMCSITILLPNDIQGLQA 238
255545428 157 EYTKYLYGVVDKLLKSLSLGLGLKEDEVKEAIGGDELVYLLKINYYPPCPRPDLALGVVAHTDMSAITILVPNDVQGLQA 236
255545424 159 EYAQLLRKIADRLHKTLSLGLGLEENEIDKALGGENLEYLLKINYYPPCPRPDLALGVVAHTDMSSLTLLVPNDVQGLQA 238
297806939 161 EYAMQVKKLSETLLGILSEGLGLKRDALREGLGGEMAEYMMKINYYPPCPRPDLALGVPAHTDLSGITLLVPNEVPGLQV 240
15242339  241 FKDDHWFDAEYIPSAVIVHIGDQILRLSNGRYKNVLHRTTVDKEKTRMSWPVFLEPPREKIVGPLPELTGDDNPPKFKPF 320
225459487 249 FRDDHWFDVKYIPNALVIHIGDQLEILSNGKYRSVLHRATVNKEMTRMSWPVFLEPPPELAIGPLSKLINEENPPKYKEK 328
225459489 241 FRDDHWFDVKYIPDALVIHIGDQLEILSNGKYKSVLHRTTVTKEITRMSWPVFLEPPSELAIGPLPKLINEKNPPKYQKK 320
225459491 241 FRDDHWFDVKYIPNALVIHIGDQLEILSNGKYKSVLHRTTVKKDMTRMSWPVFLEPPPELAIGPLPKLTSEDNPPKYKKK 320
225459493 241 FRDDHWFDVKYISNALVIHVGDQLEILSNGKYKAVLHRTTVNKEKTRMSWPVFLEPPSDQVVGPLPQLVNEENPARYKTK 320
224122686 241 FKDDHWIEAKYIPDALIIHIGDQIEILSNGKYKAVLHRTTVAKDRARMSWPVFLEPPGELVVGPLPEFINKDNPPKFKTK 320
224122694 241 FKDDHWIEAKYIPDALIIHIGDQIEILSNGKYKAVLHRTTVAKDRTRMSWPVFLEPPGELVVGPLPQFINKDNPPKFKTK 320
224145588 241 FKDGNWFEAKYIPNALIIHIGDQIEILSNGKYKAVLHRTTVAKDKARMSWPVFLEPPGELVVGPLPHLIKKDNPPKFKAK 320
224063126 239 CRDGQWYCVKYIPNALVIHIGDQIKILSNGKYKSVFHRTTVTKDKTRMSWPVFLEPPPDLAVGPHPKLVNEKNPPKYKTK 318
255545428 237 CRDGQWYDVSYISDALVIHIGDQMEILSNGKYKSVLHRTTVNKEKARMSWPVFLEPPSDFAVGPHPKLVSEENPPKYKTK 316
255545424 239 CRDGKWYNVKYISNGLVIHIGDQLEILSNGKYTSVLHRTTLNKEKTRMSWPVFLEPPSELEVGPHPKLVNAENPAKFKTK 318
297806939 241 FKDDHWFDAEYIPSAVIVHIGDQILRLSNGRYKNVLHRTTVDKEKTRMSWPVFLEPPREKIVGPLPELTGDDNPPKFKPF 320
15242339  321 AFKDYSYRKLNKLPL 335
225459487 329 KYCDYVYCKLNKIPQ 343
225459489 321 KYCDYVYCKLNKIAQ 335
225459491 321 RYCDYVYCKLNKIPQ 335
225459493 321 KYSDYVYCKLNKIPQ 335
224122686 321 KFKDYMYCKLNKLPQ 335
224122694 321 KFKDYTYCKLNKLPQ 335
224145588 321 KFEDYMYCKLNRLPQ 335
224063126 319 KYGDYCYCKLNKIPQ 333
255545428 317 KYSDYCYCKLNKIPQ 331
255545424 319 KFGDYSYCKLNKIPQ 333
297806939 321 TFKDYSYRKLNKLPL 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap