Conserved Protein Domain Family
PLN02684

?
PLN02684: PLN02684 
Probable galactinol--sucrose galactosyltransferase
Statistics
?
PSSM-Id: 166325
View PSSM: PLN02684
Aligned: 8 rows
Threshold Bit Score: 1533.72
Threshold Setting Gi: 297808097
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225445599   1 MTITSAVRIADRKLVVKERTILEGVPDNVVATSGSTSGPVEGVFLGAVFNESSSTHVVSLGTLRDVRFMACFRFKLWWMA 80 
79598832    1 MTIKPAVRISDGNLIIKNRTILTGVPDNVITTSASEAGPVEGVFVGAVFNKEESKHIVPIGTLRNSRFMSCFRFKLWWMA 80 
79328212    1 MTIKPAVRISDGNLIIKNRTILTGVPDNVITTSASEAGPVEGVFVGAVFNKEESKHIVPIGTLRNSRFMSCFRFKLWWMA 80 
15241300    1 MTIKPAVRISDGNLIIKNRTILTGVPDNVITTSASEAGPVEGVFVGAVFNKEESKHIVPIGTLRNSRFMSCFRFKLWWMA 80 
224087090   1 MTIKPAVRISDGKLIVKDRTILTGVPDNVIATSGSTSGPVEGVFLGAVFDQENSRHVTSLGALRDVRFMACFRFKLWWMA 80 
224142577   1 MTIKPAVRISESKLVVKDRTILTGVPDNVMATSGSSSGPVDGVFLGVVFDQENSRHVVSLGALRDVRFMACFRFKLWWMA 80 
255582335  29 MTIKPAVRISDRKLIVKDRTILTGLQDNVIATSGSSSSPVEGVFIGAVFDEENSRHVVPLGTLRDVRFMACFRFKLFWMA 108
297808097   1 MTIKPAVRISDGNLIIKNRTILTGLSDNVITTSASEAGPVEGVFVGAVFDKEDSKHIVSIGTLRNSRFMSCFRFKLWWMA 80 
225445599  81 QKMGDRGRDIPLETQFLLVETKDGSQIESDGAG--EENQIVYTVFLPLIEGPFRACLQGNSRDELELCLESGDADTKTSS 158
79598832   81 QRMGEMGRDIPYETQFLLVESNDGSHLESDGANgvECNQKVYTVFLPLIEGSFRSCLQGNVNDEVELCLESGDVDTKRSS 160
79328212   81 QRMGEMGRDIPYETQFLLVESNDGSHLESDGANgvECNQKVYTVFLPLIEGSFRSCLQGNVNDEVELCLESGDVDTKRSS 160
15241300   81 QRMGEMGRDIPYETQFLLVESNDGSHLESDGANgvECNQKVYTVFLPLIEGSFRSCLQGNVNDEVELCLESGDVDTKRSS 160
224087090  81 QKMGDQGRDIPLETQFLLVETKDGSHLESDGGD--EDNQVVYTVFLPLIEGSFRACLQGNVSDELELCLESGDAETKTSS 158
224142577  81 QKMGDQGRDIPLETQFLLVETKDGSHLESDGGD--EENQIVYTVFLPLIEGSFRACLQGNVDDELELCLESGDAETKRTS 158
255582335 109 QKMGDHGRDIPLETQFLMMETKDGSQLESDGGN--EENQIIYTVFLPLIEGSFRACLQGNDNDELELCLESGDVDTKAAS 186
297808097  81 QKMGEMGRDIPYETQFLLVESNDGSHLEPDGS-----NQKVYTVFLPLIEGSFRSCLQGNVNDEVELCLESGDVDTKRSS 155
225445599 159 FTHSVFISAGTDPFATITSAIRAVKLHLKTFRLRHEKKLPGIVDYFGWCTWDAFYQEVTPEGVEAGLQSLAAGGTPPKFV 238
79598832  161 FTHSLYIHAGTDPFQTITDAIRTVKLHLNSFRQRHEKKLPGIVDYFGWCTWDAFYQEVTQEGVEAGLKSLAAGGTPPKFV 240
79328212  161 FTHSLYIHAGTDPFQTITDAIRTVKLHLNSFRQRHEKKLPGIVDYFGWCTWDAFYQEVTQEGVEAGLKSLAAGGTPPKFV 240
15241300  161 FTHSLYIHAGTDPFQTITDAIRTVKLHLNSFRQRHEKKLPGIVDYFGWCTWDAFYQEVTQEGVEAGLKSLAAGGTPPKFV 240
224087090 159 FTHTLFIHAGTDPFRTITEAVRAVKLHLKTFRQRHEKRLPGIIDHFGWCTWDAFYQEVTQEGVEAGLQSLASGGTPPKFV 238
224142577 159 FSHSVFIHAGTDPFRTITEAVRAVKLHLKTFRQRHEKKLPGIVDYFGWCTWDAFYQEVTQEGVEAGLESLASGGTPPKFV 238
255582335 187 FTHPLFIHAGTDPFGTLTEAVRAVKLHLKSFRQRHEKKLPAIIDYFGWCTWDAFYQEVTQEGVEAGLKSLSEGGTLPKFV 266
297808097 156 FTHSLYIHAGTDPFQTITDAIRTVKLHLNSFRQRHEKKLPGIVDYFGWCTWDAFYQEVTQEGVEAGLESLSAGGTPPKFV 235
225445599 239 IIDDGWQSVGGDPQKDEDQTENk---QQPLLRLTGIKENSKFQNKEDPTGGIKSIVNIAKQKHGLKYVYVWHAITGYWGG 315
79598832  241 IIDDGWQSVERDATVEAGDEKK----ESPIFRLTGIKENEKFKKKDDPNVGIKNIVKIAKEKHGLKYVYVWHAITGYWGG 316
79328212  241 IIDDGWQSVERDATVEAGDEKK----ESPIFRLTGIKENEKFKKKDDPNVGIKNIVKIAKEKHGLKYVYVWHAITGYWGG 316
15241300  241 IIDDGWQSVERDATVEAGDEKK----ESPIFRLTGIKENEKFKKKDDPNVGIKNIVKIAKEKHGLKYVYVWHAITGYWGG 316
224087090 239 IIDDGWQSVGGDPEEETNGQDVkkqdQQPLLRLTGIKENAKFQKKDDPAAGIKSIVNIAKEKYGLKYVYVWHAITGYWGG 318
224142577 239 IIDDGWQSVGGDPQEESNDQDEkkenQQPLLRLTGIKENAKFQKKDDPTAGIKSIVNVAKEKHGLKYVYVWHAITGYWGG 318
255582335 267 IIDDGWQSVGGDPQEDDEDK------PQPLLRLIGIKENEKFRKKDDPTVGIKNIVNIAKEKYGLKYVYVWHAITGYWGG 340
297808097 236 IIDDGWQSVERDDTVETGDEKK----EQAVSRLTGIKENEKFKNKDDPNVGIKNIVKIAKEKHGLKYVYVWHAITGYWGG 311
225445599 316 VRPGvkemEQYDSLMKYPMVSKGVVENEPVWKTDVMTLQGLGLVNPKNVYRFYNELHEYLASAGIDGVKVDVQCILETLG 395
79598832  317 VRPG----EEYGSVMKYPNMSKGVVENDPTWKTDVMTLQGLGLVSPKKVYKFYNELHSYLADAGVDGVKVDVQCVLETLG 392
79328212  317 VRPG----EEYGSVMKYPNMSKGVVENDPTWKTDVMTLQGLGLVSPKKVYKFYNELHSYLADAGVDGVKVDVQCVLETLG 392
15241300  317 VRPG----EEYGSVMKYPNMSKGVVENDPTWKTDVMTLQGLGLVSPKKVYKFYNELHSYLADAGVDGVKVDVQCVLETLG 392
224087090 319 VRPGvkemEEYGSMMKYPMVSKGVVENEPIWKNDALTLQGLGLVNPKNVYRFYNELHSYLAAAGIDGVKVDVQCILETLG 398
224142577 319 VRPEvkemEEYGSTLKYLMVSKGVVENDPTWKNDALALQGLGLVNPKNVYKFYNELHSYLASAGIDGVKVDVQCILETLG 398
255582335 341 VRPGvkemEEYGSLMKYPKVSEGVLENEPTWRTDVLAVQGLGLMNPKAVYKFYNELHNYLASAGIDGVKVDVQCILETLG 420
297808097 312 VRPG----GEYGSVMKYPNMSKGVVENDPTWKTDIMALQGLGLVSPKKVYKFYNELHSYLADAGVDGVKVDVQCILETLG 387
225445599 396 AGLGGRVELTTQYHKALDASVARHFPDNGIIACMSHNTDALYCSKQTAVVRASDDFYPRDPVSHTIHIAAVAYNSVFLGE 475
79598832  393 GGLGGRVELTRQFHQALDSSVAKNFPDNGCIACMSHNTDALYCSKQAAVIRASDDFYPRDPVSHTIHIASVAYNSVFLGE 472
79328212  393 GGLGGRVELTRQFHQALDSSVAKNFPDNGCIACMSHNTDALYCSKQAAVIRASDDFYPRDPVSHTIHIASVAYNSVFLGE 472
15241300  393 GGLGGRVELTRQFHQALDSSVAKNFPDNGCIACMSHNTDALYCSKQAAVIRASDDFYPRDPVSHTIHIASVAYNSVFLGE 472
224087090 399 AGLGGRVELTRQYHQALDASVARNFLDNGCIACMSHNTDALYCSKQTAVVRASDDFYPRDPVSHTIHIAAVAYNSVFLGE 478
224142577 399 AGLGGRVQLTRQYHQALDASVARNFPDNGCIACMSHNTDALYCSKQTAVVRASDDFYPHDPVSHTIHIAAVAYNSVFLGE 478
255582335 421 AGLGGRVEITRQYHQALDASVARNFPDNGCIACMSHNTDALYCSKQTAVVRASDDFFPRDPVSHTIHIAAVAYNSVFLGE 500
297808097 388 GGLGGRVELTRQFHQALDSSVAKNFPDNGCIACMSHNTDALYCSKQAAVIRASDDFYPRDPVSHTIHIASVAYNSVFLGE 467
225445599 476 IMQPDWDMFHSLHSAAEYHASARAISGGPIYVSDAPGKHNYELLKKLVLPDGSVLRARLPGRPTRDCLFSDPARDGISLL 555
79598832  473 FMQPDWDMFHSVHPAAEYHASARAISGGPLYVSDSPGKHNFELLRKLVLPDGSILRARLPGRPTRDCLFADPARDGVSLL 552
79328212  473 FMQPDWDMFHSVHPAAEYHASARAISGGPLYVSDSPGKHNFELLRKLVLPDGSILRARLPGRPTRDCLFADPARDGVSLL 552
15241300  473 FMQPDWDMFHSVHPAAEYHASARAISGGPLYVSDSPGKHNFELLRKLVLPDGSILRARLPGRPTRDCLFADPARDGVSLL 552
224087090 479 FMQPDWDMFHSLHAAAEYHASARAISGGPIYVSDAPGKHNFELLKKVVLPDGSILRARLPGRPTSDCLFSDPARDGVSLL 558
224142577 479 FMQPDWDMFHSLHPTAEYHASARAISGGPIYVSDAPGKHNFELLKKLILPDGSILRARLPGRPTRDCLFSDPARDGVSLL 558
255582335 501 FMQPDWDMFHSLHPAAEYHASARAISGGPVYVSDEPGKHDFNVLKKLVLPDGSILRARLPGRPTRDCLFSDPARDGISLL 580
297808097 468 FMQPDWDMFHSLHPAAEYHASARAISGGPLYVSDAPGKHNFELLRKLVLPDGSILRARLPGRPTRDCLFADPARDGVSLL 547
225445599 556 KIWNMNKYTGVIGVYNCQGAAWNSAERKNTFHETHSGAITGTIRGRDVHLIAEAATDPE-WSGDCAVYCHKSGELITLPH 634
79598832  553 KIWNMNKYTGVLGVYNCQGAAWSSTERKNIFHQTKTDSLTGSIRGRDVHSISEASTDPTtWNGDCAVYSQSRGELIVMPY 632
79328212  553 KIWNMNKYTGVLGVYNCQGAAWSSTERKNIFHQTKTDSLTGSIRGRDVHSISEASTDPTtWNGDCAVYSQSRGELIVMPY 632
15241300  553 KIWNMNKYTGVLGVYNCQGAAWSSTERKNIFHQTKTDSLTGSIRGRDVHSISEASTDPTtWNGDCAVYSQSRGELIVMPY 632
224087090 559 KIWNMNKFTGVLGVYNCQGAAWSSTERKNAFHQTTTEALTGTIRGRDVHLVAEAATDPN-WDGNCAFYCHRTGELITLPY 637
224142577 559 KIWNMNKFTGVLGVYNCQGAAWNNTERKNTFHQTKNEVLTGAIRGRDVHLIAEAAMDPN-WDGNCAVYCHRTGELITLPY 637
255582335 581 KIWNMNKHTGVLGVYNCQGAAWNCVERKNTFHETKSEALTGAIKGRDVHLIAEAATDSN-WNGDCAVYCHQTAELTTVPY 659
297808097 548 KIWNMNKYTGVLGVYNCQGAAWSSTERKNIFHQTKTDSLTGSICGRDVHLISEASTDPRtWNGDCAVYSQSRGELIIMPY 627
225445599 635 NAALPVSLKVLEHEILTVTPIKVLA-PGFSFAPFGLINMFNAGGAIQELRYEVKk------------------------- 688
79598832  633 NVSLPVSLKIREHEIFTVSPISHLV-DGVSFAPIGLVNMYNSGGAIEGLRYEAE-------------------------- 685
79328212  633 NVSLPVSLKIREHEIFTVSPISHLV-DGVSFAPIGLVNMYNSGGAIEGLRYEAE-------------------------- 685
15241300  633 NVSLPVSLKIREHEIFTVSPISHLV-DGVSFAPIGLVNMYNSGGAIEGLRYEAE-------------------------- 685
224087090 638 NAALPVSLKVLEHDIFTVTPIKVLA-PGFSFAPLGLINMFNAGGAIEGLKYEVK-------------------------- 690
224142577 638 NAALPMSLKVLEHDIFTVTPIKDLA-PGFSFAPLGLINMFNAGGAIEGLKYEVK-------------------------- 690
255582335 660 NASLPVSLKVLEHEIFTLTPIKVLA-PGFSFAPLGLIAMYNAGGAIEGLKYEVKgvklveldegykgenstvsderveni 738
297808097 628 NVSLPISLKIREHEIFTVSPIKHLAtDGISFAPLGLVNMYNSGGAIEGLKYEAE-------------------------- 681
225445599 689 ---lVGVVHMEVKGCGRFGAYSSAKPRRCTLGSIEVDFIYNSSFGLVTLNLSHMPEEGQNVHVVKVEI 753
79598832  686 ----KMKVVMEVKGCGKFGSYSSVKPKRCVVESNEIAFEYDSSSGLVTFELDKMPIENKRFHLIQVEL 749
79328212  686 ----KMKVVMEVKGCGKFGSYSSVKPKRCVVESNEIAFEYDSSSGLVTFELDKMPIENKRFHLIQVEL 749
15241300  686 ----KMKVVMEVKGCGKFGSYSSVKPKRCVVESNEIAFEYDSSSGLVTFELDKMPIENKRFHLIQVEL 749
224087090 691 -----GKVCVEVKGCGKFGAYSSAKPRKCIVDSNVVDFVYDSNSGLVGFNLDSLLEEGK-LRIVEIEL 752
224142577 691 -----GKVSMEVKGCGKFGAYSSAKPRKCIVDANVVEFVYDSDSSLVSLSLDSMPEEGK-LHVVEIEL 752
255582335 739 sselVGKICMEVKGCGKFGAYSSTKPRMCIVDSNIAEFEYDSSSGLVTFNLDNLAEEGR-LHLVEVEV 805
297808097 682 ----KMKVVMEVKGCGKFGSYSSVKPKRCVVESNEIAFEYDSSSGLVTFELDKMPVETKRLHLIEVEL 745
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap