Conserved Protein Domain Family
PLN02663

?
PLN02663: PLN02663 
hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyltransferase
Statistics
?
PSSM-Id: 166304
View PSSM: PLN02663
Aligned: 6 rows
Threshold Bit Score: 925.129
Threshold Setting Gi: 297853374
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15239747    1 MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEALSKALVPFYPMAGRLKRDDDG 80 
224072741  25 MIINLKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDAKVLKEALSKALVPFYPMAGRLRRDDDG 104
224115832   1 MIINVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSKALVPFYPMAGRLRRDEDG 80 
225443204   1 MIINVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSKVLVPFYPMAGRLRRDEDG 80 
255543353   1 MIINVKESTLVPPSEETPRVGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDPDVLKAALGKALVPFYPMAGRLRRDEDG 80 
297853374   1 MKINIRDSTMVRPAAETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQIMKDALSKALVPFYPMAGRLKRDDDG 80 
15239747   81 RIEIDCNGAGVLFVVADTPSVIDDFGDFAPTLNLRQLIPEVDHSAGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADGFS 160
224072741 105 RIEIDCNAEGVLFVEAGTASVVADFGDFAPTLELKQLIPTVDYSGGISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGFS 184
224115832  81 RIEINCNAEGVLFVEAETTSVIDDFADFAPTLELKQLIPTVDYSGGISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGFS 160
225443204  81 RIEIDCNAEGVLFVEADTGSVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGAS 160
255543353  81 RIEIDCNAEGVLLVVAETNAVVDDFGDFAPTLELKQLIPTVDYSGGISTFPLLVLQVTHFKCGGVSLGVGMQHHAADGFS 160
297853374  81 RIEIDCNGAGVLFVVADTPSVIDDFGDFAPTLNLRQLIPDVDHSAGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADGFS 160
15239747  161 GLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMKIPLDPSKsgPENTTVSIFKLTRDQLVALKA 240
224072741 185 GLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPPPAMKTVLETSK--PESTAVSIFKLTRDQLNTLKA 262
224115832 161 GLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHVEYQPPPSMKTVLETSK--PESTAVSIFKLSRDQLSTLKA 238
225443204 161 GLHFINTWSDMARGLDITIPPFIDRTLLRARDPPQPAFHHIEYQPPPQLKTPLPNTQ----NTNVCIFRITRDQLNTLKN 236
255543353 161 GLHFVNTWSDMARGLDCTIPPFIDRTLLRARDPPQPQFNHIEYQPPPALKASAETLK--PDSTTVSIFKLSRDQLNILKA 238
297853374 161 GLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMRIPLDPSKsgPDNTTVSIFKLSRDQLVALKA 240
15239747  241 KSKEDGNTVSYSSYEMLAGHVWRSVGKARGLPNDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTW 320
224072741 263 KAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTW 342
224115832 239 KAKEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTW 318
225443204 237 KSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMYIATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLW 316
255543353 239 KAKEDGNTINYSSYAMLAGHVWRSACKARGLTDDQETKLYIATDGRSRLNPPLPPGYFGNVIFTATPIAVAGDLESKPTW 318
297853374 241 KSKEDGNIVSYSSYEMLAGHVWRSVGKARGLPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTW 320
15239747  321 YAAGQIHDFLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLS 400
224072741 343 YAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS 422
224115832 319 YAAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS 398
225443204 317 YAASKIHNALARMDDEYLRSALDYLELQPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLA 396
255543353 319 YAAGKIHDALARMDNDYLRSALDFLELQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS 398
297853374 321 YAAGLIHDVLVRMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLS 400
15239747  401 FVLPSPTNDGSLSVAIALQSEHMKLFEKFLFEI 433
224072741 423 FIIPSSTNDGSLSVAISLQAEHMKLFEKFIYDI 455
224115832 399 FILPSPTNDGSMSVAISLQAQHMKLFEKFIYDI 431
225443204 397 FALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI 429
255543353 399 FILPSPTNDGSLSVAIALQSEHMKLFEKFIYEL 431
297853374 401 FVLPSPTNDGSLSVAIALQSEHMKLFEKFLYEI 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap