Conserved Protein Domain Family
PLN02622

?
PLN02622: PLN02622 
iron superoxide dismutase
Statistics
?
PSSM-Id: 166263
View PSSM: PLN02622
Aligned: 5 rows
Threshold Bit Score: 457.937
Threshold Setting Gi: 224083876
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15237281    1 MSSCVVTTSCFYtISDSSIRLKSPKLLNLSNQQRRRSLRSRGglKVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHR 80 
225462551   5 CNNSFPASSHVL-LTDLSQRWKCPKLQNLRHKGQFHGSQKAS--KVLAFYGLKAPPYKLDALEPHMSRRTLEMHWGDHHR 81 
224083876   1 --------------------------------------QRAS--RVVSYYALKTPPYKLDALEPYMSKRTVEVHWKEHHG 40 
255559792   5 CNLSPPRSRLLVgDYSLQLKNLDLKLLSLRNKQKRRQFQRAS--KLVAYYGLKTPPYPLDALEPYMSRKTLEIHWGEHHR 82 
297808333   1 MSSFVVTTSCFCtNSDSSIRLKSSKLVNLSNQQRRYSLRSRGglKVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHR 80 
15237281   81 GYVDNLNKQLGKDDRLYGYTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQPGGGDTPQKGVLEQIDKDFGSFTNF 160
225462551  82 GYVEGLNKQLEKDDILYGHTLDELVKVTYNNGNPLPEFNNAAQVWNHDFFWESMQPGGGDMPRLGLLEQIEKDFGSFTNF 161
224083876  41 AYVEGLNKALAKSDILYGYTLDDLVKVTYNNGNPSPDFNNAAQVWNHDFFWESMQPGGGDMPELGMLEQIEKDFGSFTNF 120
255559792  83 AYVEGLNKQLAKDDILYGYTMDELVKVTYNNGNPFPEFNNAAQVWNHDFFWESMQPAGGEMPELGVLQQIEKDFGSFTNF 162
297808333  81 GYVDNLNKQLGKDDRLYGYTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQPGGGDMPKKGVLEQIDKDFGSFTNF 160
15237281  161 REKFTNAALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIICVDVWEHSYYLDYKNDRAKYINTFLNHLVSWN 240
225462551 162 KEKFLEAALTLFGSGWVWLVLKRNERCLAVVKTSNAINPIVWDDIPIISLDVWEHAYYLDYKNDKGKYATVFMNHLVSWN 241
224083876 121 RNKFAETALTLFGSGWVWLVLKREEPRLEVVKTLNAVTPIVWGDIPIINLDMWEHAYYLDYKNDKENYVNAFMDHLVSWN 200
255559792 163 KEKFIEEALTLFGSGWIWLVLKREERQLAIIKTSNANNPLVWDDIPIICLDMWEHAYYLDYKNDRGKYVNAFMNHLISWN 242
297808333 161 REKFTNAALTQFGSGWVWLVLKREERRLEVVKTSNAINPLVWDDIPIISLDVWEHSYYLDYKNDRARYINTFLNHLVSWN 240
15237281  241 AAMSRMARAEAFVNLGEPNIPIA 263
225462551 242 AAAARMARAEAFVNLGEPKIPIA 264
224083876 201 MAMARMARAEAFVNLGEPKIPIA 223
255559792 243 AVMARMARAEAFVNLGEPKIPVA 265
297808333 241 AAMSRMARAEAFVNLGEPNIPIA 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap