Conserved Protein Domain Family
PLN02620

?
PLN02620: PLN02620 
indole-3-acetic acid-amido synthetase
Statistics
?
PSSM-Id: 166261
View PSSM: PLN02620
Aligned: 12 rows
Threshold Bit Score: 1296.05
Threshold Setting Gi: 225447427
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224124694   1 MPEEAPMKNL----------VCEKSRKALQFIEDVTRNADEVQRKVLAEILSRNANVEYLQRYGLNGnKADREAFKKVMP 70 
15237038    1 MPEAPKKESLevf----dltLDQKNKQKLQLIEELTSNADQVQRQVLEEILTRNADVEYLRRHDLNG-RTDRETFKNIMP 75 
15239653    1 MPEAPKIAALevs----desLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLEG-RTDRETFKHIMP 75 
225447427   1 MPEAPKNRGNgaglgveggiLDDKNIRALEFIEDVTMNAKEVQMQVLSEIITRNSNVEYLQRHGLNG-RVDADTFKKIVP 79 
225461199   1 MPEAPKKSFKatgh---dycLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEYLHRHGLGG-HTDRDTFKKLMP 76 
225461201   1 MPEAPKKSFKatgh---dycLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEYLHRHGLGG-HTDRDTFKKLMP 76 
225461203   1 --------------------MVNKSLNLCLFIEDVTTNADQVQKRVLAEILTRNAHVEYLHRHGLGG-HTDRDTFKKLMP 59 
224124160   1 MPEAPKNTLKtsd-----ynLAEKNKISLQFIEDVTSNADEVQKKVLEEILSRNAHVEYLQRHGLNG-QTNRETFKKAVP 74 
224115146   1 MPEAPKNTLKpsd-----ynLAEKNKKSLQFIEDVTSNADEAQKKVLEEILSRNAHVEYLQRHGLNG-QTNRETFKKVMP 74 
255586158   1 MPEAPKNSLIssd-----ynLSEKNRKTLQFIEDVTSNPDEVQKKVLEEILTRNARVEYLQKHGLNG-YTDRESFKKIMP 74 
297803374   1 MPEAPKKVSLevf----dltLDQKNKQKLQLIEELTSNADQFQRRVLEEILSRNADVEYLRRHYLNG-RTDRETFKNVMP 75 
297796323   1 MPEAPKIVALevs----desLAEKNKNKLQFIEDVTTNADDVQRRVLEEILSRNADVEYLKRHGLDG-RTDRETFKHVMP 75 
224124694  71 VVSYEDLKPDIDRIANGDTSQIICSQPISEFLTSSGTSAGERKLMPTIEEELGRRSLLYSLLMPVMNQFVPGLDRGKGMY 150
15237038   76 VITYEDIEPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMSQFVPGLENGKGMY 155
15239653   76 VVTYEDIQPEINRIANGDKSQVLCSNPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMDQFVPGLDKGKGMY 155
225447427  80 VVTYEDMLPDIERIANGDMSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYSLLMPVMNQSVPGLDEGKGMY 159
225461199  77 VITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSLLMPVMSQSVQGLEKGKGMY 156
225461201  77 VITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSLLMPVMSQSVQGLEKGKGMY 156
225461203  60 VITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMPTIEEELERRSLLYSLLMPVMSQSVQGLEKGKGMY 139
224124160  75 VITYEDIQPDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYSLLMPVMTQFVPGLEKGKGMY 154
224115146  75 VINYEDIQPDINRIANGDASPILCSKPISEFLTSSGTSGGERKLMPTIVEELGRRSLLYSLLMPVMSQFVPDLEKGKGMY 154
255586158  75 VIAYEDIQPHINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGRRSLLYSLLMPVMNQFVPGLEKGKGMY 154
297803374  76 VITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMSQFVPGLENGKGMY 155
297796323  76 VVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDRRSLLYSLLMPVMNQFVPGLDKGKGMY 155
224124694 151 FLFIKSETKTPGGLLARPVLTSYYKSSYFRDRPYDPYTNYTSPNETILCQDSYQSMYSQLLCGLYQNYDVLRVGAVFASG 230
15237038  156 FLFIKSESKTPGGLPARPVLTSYYKSSHFKERPYDPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASG 235
15239653  156 FLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPYDPYTNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASG 235
225447427 160 FLFVKSEAKTPGGLMARPVLTSYYKSSYFRDRPYDPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASG 239
225461199 157 FLFIKSEAKTPGGLVARPVLTSYYKSSHFRERPYDPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASG 236
225461201 157 FLFIKSEAKTPGGLVARPVLTSYYKSSHFRERPYDPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASG 236
225461203 140 FLFIKSEAKTPGGLVARPVLTSYYKSSHFRERPYDPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASG 219
224124160 155 FLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPYDPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASG 234
224115146 155 FLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPYDPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASG 234
255586158 155 FLFIKSEAKTPGGLVARPVLTSYYKSSHFKDRPFDPYTNYTSPNETILCPDSYQSMYSQMLCGLCQRNDVLRVGAVFASG 234
297803374 156 FLFIKSESKTPGGLPARPVLTSYYKSSHFKERPYDPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASG 235
297796323 156 FLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPFDPYNNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASG 235
224124694 231 FIRAIKFLEKHWILLCNDIRNGTIDPKISDPSVREAVLKILKPNQKLADFIEAECTRESWKGIITRLWPNTKYIDVIVTG 310
15237038  236 FIRAIKFLEKHWIELVRDIRTGTLSSLITDPSVREAVAKILKPSPKLADFVEFECKKSSWQGIITRLWPNTKYVDVIVTG 315
15239653  236 FIRAIKFLEKHWPELARDIRTGTLSSEITDSSVREAVGEILKPDPKLADFVESECRKTSWQGIITRLWPNTKYVDVIVTG 315
225447427 240 FIRAIRFLEKHWVLLCKDIRAGTLDSQINDPSVREAVKRILKPNPELADFIEAECRRESWEGIITRLWPNTKYIDVIVTG 319
225461199 237 FIRAIRFLEKHWTLLCRDIRTGTIDQQITDPSVREAVMRVLKPDPKLADFVEGECRKESWQGIITRLWPNTKYVDVIVTG 316
225461201 237 FIRAIRFLEKHWTLLCRDIRTGTIDQQITDPSVREA----------------GECRKESWQGIITRLWPNTKYVDVIVTG 300
225461203 220 FIRAIRFLEKHWTLLCRDIRTGTIDQQITDPSVREAVMRVLKPDPKLADFVEGECRKESWQGIITRLWPNTKYVDVIVTG 299
224124160 235 FIRAIRFLEKHWKLLANDIRTGIIDPQITDPSVREAVMKILKSDPKLADFIEAECSKESWQGIITRLWPNTKYVDVIVTG 314
224115146 235 FIRAIRFLEKYWKFLANDIRTGIIDPQITDPSIREAVMKILKPDAKLADFIEAECSKESWQGIITRLWPNTKYVDVIVTG 314
255586158 235 FIRAIRFLEKHWQLLCNDIRTGTVNPQITDLSVREAVMKILKPDPKLADFIAAECSQESWQGIITRLWPNTKYVDVIVTG 314
297803374 236 FIRAIKFLEKHWTELVRDIRTGTLSSLITDPSVREAVSKILKPNSKLAEFVEFECKKSSWQGIITRLWPNTKYVDVIVTG 315
297796323 236 FIRAIKFLEKHWSELARDIRTGTLSSEITDLSVREAVGEILKPDPKLADFVESECRKTSWQGIITRLWPNTKYVDVIVTG 315
224124694 311 TMSQYIPTLDYYCDGLPLVCTMYASSECYFGLNLNPLSKPSEVSYTLIPTMAYFEFLPVNRKNGLINSITAPTSLDQKKD 390
15237038  316 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMAYFEFLPVHRNNGVTNSINLPKALTEKEQ 395
15239653  316 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMAYFEFLPVHRNSGVTSSISLPKALTEKEQ 395
225447427 320 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGLNLNPLCKPSEVSYTLIPTMAYFEFLPVNRKNXXMR----------RNI 389
225461199 317 TMSQYIPTLDYYSNDLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFEFLPVHRNNG-TNSISVPKSLNDKEQ 395
225461201 301 TMSQYIPTLDYYSNDLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFEFLPVHRNNG-TNSISVPKSLNDKEQ 379
225461203 300 TMSQYIPTLDYYSNDLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFEFLPVHRNNG-TNSISVPKSLNDKEQ 378
224124160 315 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMAYFEFLPVHRNNGVINSVSMPKSLNEKEQ 394
224115146 315 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMAYFEFLPVNRNNGGINSVSRPKSLKEKEQ 394
255586158 315 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMAYFEFLPVHRNNGVTNSISMPKSLNEKEQ 394
297803374 316 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMAYFEFLPVHRNNGVTNSINLPKALTEKEQ 395
297796323 316 TMSQYIPTLDYYSNGLPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMAYFEFLPVHRNSGVTSSISLPKALTEKEQ 395
224124694 391 QELVDLVDVKLGEEYELVVTTYAGLYRYRVGDILRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAVQNAANHLL 470
15237038  396 QELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLV 475
15239653  396 QELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLSVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLV 475
225447427 390 RKLVDLVDVKLGQEYELVVTTYAGLYRYRVGDILCVAGFKNKAPQFKFICRKNVALSIDSDKTDEFELQNAVKNAADHLL 469
225461199 396 QDLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLM 475
225461201 380 QDLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLM 459
225461203 379 QDLVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLM 458
224124160 395 QELVDLVDVKLDQEYELVVTTYAGLYRYRVGDVLRVVGFKNKAPRFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLI 474
224115146 395 QELVDLVDVKLDQEYELVVTTYAGLYRYRVGDVLRVVGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLI 474
255586158 395 QELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLV 474
297803374 396 QELVDLVDVKLGQEYELVVTTYAGLCRYRVGDLLRVTGFKNKAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTYLV 475
297796323 396 QELVDLVDVKLGQEYELVVTTYAGLYRYRVGDVLSVAGFKNNAPQFSFICRKNVALSIDSDKTDEVELQNAVKNAVTHLV 475
224124694 471 PFGASLTEYTSYADTSKIPGHYVLFWEICLSGTTPIPPSVFEDCCLAIEESLNSVYRQGRVSDKSIGPLEIRITERGAFD 550
15237038  476 PFDASLSEYTSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNTVYRQGRVSDKSIGPLEIKIVEPGTFD 555
15239653  476 PFDASLSEYTSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKMVESGTFD 555
225447427 470 QFDASVTEYTSYADTSTIPGHYVLYWEIGLSGATPIPPSVFEDCCLIMEESLNSVYRQGRASDKSIGPLEIRIVEGGTFD 549
225461199 476 PFDATLTEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSIGPLEMKIVESGTFD 555
225461201 460 PFDATLTEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSIGPLEMKIVESGTFD 539
225461203 459 PFDATLTEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSIGPLEMKIVESGTFD 538
224124160 475 PFDATLAEYTSYADTTTIPGHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPLEIKIVEPGTFD 554
224115146 475 PFDATLAEYTSYADTTTIPGHYVLFWELSLSGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEPGTFD 554
255586158 475 PFDATLAEYTSYADTTSIPGHYVLFWEITLNGSTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKIVEPGTFD 554
297803374 476 PFDASLSEYTSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLTVEESFNTVYRQGRVSDKSIGPLEIKIVEPGTFD 555
297796323 476 PFDASLSEYTSYAETSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKMVESGTFD 555
224124694 551 KLMDFALSQGASINQYKAPRCVKYAPIIELLNSRVVSNYISPKCPKWVPGHKQWCTP 607
15237038  556 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWVPGHKQWGSN 612
15239653  556 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWSPGHKQWGSN 612
225447427 550 KLMDYALSQGASINQYKTPRCVKYAPIIELLNSRVVSNYFSPKCPKWVAGHKQWCT- 605
225461199 556 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNK 612
225461201 540 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNK 596
225461203 539 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNK 595
224124160 555 KLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVTCYFSPKCPKWAPGHKQWSKN 611
224115146 555 KLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSRYFSPKCPKWVPGHKQWNKN 611
255586158 555 KLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQWGNK 611
297803374 556 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVNSYLSPKCPKWVPGHKQWGSN 612
297796323 556 KLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPKCPKWAPGHKQWGSN 612
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap