Conserved Protein Domain Family
PLN02614

?
PLN02614: PLN02614 
long-chain acyl-CoA synthetase
Statistics
?
PSSM-Id: 166255
View PSSM: PLN02614
Aligned: 4 rows
Threshold Bit Score: 1403.23
Threshold Setting Gi: 297799606
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15236634    1 MSQQKKYIFQVEEGKEGSDGRPSVGPVYRSIFAKDGFPDPIEGMDSCWDVFRMSVEKYPNNPMLGRREIVDGKPGKYVWQ 80 
15237023    1 MTSQKRFIFEVEAAKEATDGNPSVGPVYRSTFAQNGFPNPIDGIQSCWDIFRTAVEKYPNNRMLGRREISNGKAGKYVWK 80 
297799606   1 MSQQKKFIFQVEEGKEGSDGRPSVGPVYRSIYAKDGFPEPIEGMDSCWDVFRMSVEKYPNNPMLGRREIVDGKPGKYVWQ 80 
297809319   1 MTSQIRFIFEVEAAKEATDGNPSVGPVYRSTFAKDGFPNPIDGIQSCWDIFRTAVEKYPNNRMLGSREIVNGKAGKYVWK 80 
15236634   81 TYQEVYDIVMKLGNSLRSVGVKDEAKCGIYGANSPEWIISMEACNAHGLYCVPLYDTLGADAVEFIISHSEVSIVFVEEK 160
15237023   81 TYKEVYDIVIKLGNSLRSCGIKEGEKCGIYGINCCEWIISMEACNAHGLYCVPLYDTLGAGAVEFIISHAEVSIAFVEEK 160
297799606  81 TYQEVYDIVIKLGNSLRSVGVKDEAKCGIYGANSPEWIISMEACNAHGLYCVPLYDTLGASAVEFIISHSEVSIVFVEEK 160
297809319  81 TYKEVYDIVIKLGNSLRSCGIQEGEKCGIYGINCCEWIISMEACNAHGLYCVPLYDTLGAGAVEFIISHAEVSIAFVEEK 160
15236634  161 KISELFKTCPNSTEYMKTVVSFGGVSREQKEEAETFGLVIYAWDEFLKLGEGKQYDLPIKKKSDICTIMYTSGTTGDPKG 240
15237023  161 KIPELFKTCPNSTKYMKTVVSFGGVKPEQKEEAEKLGLVIHSWDEFLKLGEGKQYELPIKKPSDICTIMYTSGTTGDPKG 240
297799606 161 KISELFKTCPNSTEYMKTVVSFGGVSREQKEEAETFGLVIYAWDEFLKLGEGKQYNLPIKKKSDICTIMYTSGTTGDPKG 240
297809319 161 KIPELFKTCPNSTKYMKTVVSFGGVKPEQKEEAEKLGLVIHSWDEFLKLGEDKQYDLPIKKQSDICTIMYTSGTTGDPKG 240
15236634  241 VMISNESIVTLIAGVIRLLKSANEALTVKDVYLSYLPLAHIFDRVIEECFIQHGAAIGFWRGDVKLLIEDLAELKPTIFC 320
15237023  241 VMISNESIVTITTGVMHFLGNVNASLSEKDVYISYLPLAHVFDRAIEECIIQVGGSIGFWRGDVKLLIEDLGELKPSIFC 320
297799606 241 VMISNESIVTLIAGVIRLLKSANVALTVKDVFLSYLPLAHIFDRVIEECFIQHGAAIGFWRGDVKLLLEDLGELKPTIFC 320
297809319 241 VLISNESIVTITTGVMHFLGNVNASLSEKDVYISYLPLAHVFDRAIEECIIQVGGSIGFWRGDVKLLIEDLGELKPSIFC 320
15236634  321 AVPRVLDRVYSGLQKKLSDGGFLKKFIFDSAFSYKFGYMKKGQSHVEASPLFDKLVFSKVKQGLGGNVRIILSGAAPLAS 400
15237023  321 AVPRVLDRVYTGLQQKLSGGGFFKKKVFDVAFSYKFGNMKKGQSHVAASPFCDKLVFNKVKQGLGGNVRIILSGAAPLAS 400
297799606 321 AVPRVLDRVYSGLQKKLSDGGFLKKFLFDSAFSYKFGHMKKGKPHAEASPLCDKHVFGKVKQALGGNVRIILSGAAPLAS 400
297809319 321 AVPRVLDRVYTGLQQKLSVGGFFKKKVFDVAFSYKFGNMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLAS 400
15236634  401 HVESFLRVVACCHVLQGYGLTESCAGTFVSLPDELGMLGTVGPPVPNVDIRLESVPEMEYDALASTARGEICIRGKTLFS 480
15237023  401 HIESFLRVVACCNVLQGYGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKTLFS 480
297799606 401 HVESFLRVVACCHVLQGYGLTESCAGTFVSLPDELDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKTLFS 480
297809319 401 HIESFLRVVACCNVLQGYGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKTLFS 480
15236634  481 GYYKREDLTKEVLIDGWLHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENIENIYGEVQAVDSVWVYGNSFESFLI 560
15237023  481 GYYKREDLTKEVFIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLENVYSQVEVIESIWVYGNSFESFLV 560
297799606 481 GYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIENIYGEVQAVDSVWVYGNSFESFLV 560
297809319 481 GYYKREDLTKEVLIDGWLHTGDIGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLENVYSQVEVIESIWVYGNSFESFLV 560
15236634  561 AIANPNQHILERWAAENGVSGDYDALCQNEKAKEFILGELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKR 640
15237023  561 AIANPAQQTLERWAVENGVNGDFNSICQNAKAKAFILGELVKTAKENKLKGFEIIKDVHLEPVAFDMERDLLTPTYKKKR 640
297799606 561 AIANPNQQILERWAAENGVSGDYNALCQNEKAKEFILGELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKR 640
297809319 561 AIANPAQQTLERWAVENGVNGDFNSLCQNAKAKAFILGELVKIAKEKKLKGFEIIKAIHLEPVAFDMERDLLTPTYKKKR 640
15236634  641 PQLLKYYQSVIDEMYKTINAKFASRG 666
15237023  641 PQLLKYYQNVIHEMYKTTKESLASGQ 666
297799606 641 PQLLKYYQSVIDEMYKTTNEKLASRG 666
297809319 641 PQLLKYYQNVIDEMYKAAKEGQASGQ 666
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap