Conserved Protein Domain Family
PLN02589

?
PLN02589: PLN02589 
caffeoyl-CoA O-methyltransferase
Statistics
?
PSSM-Id: 166230
View PSSM: PLN02589
Aligned: 7 rows
Threshold Bit Score: 542.277
Threshold Setting Gi: 15235213
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15235213   13 STNGEDQKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNA 92 
224103619   1 MATNGEEQQSQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNA 80 
224056110   1 MAANGEEQQTQAGRHQEVGHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINA 80 
225428851   1 -----MATKQEAGRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSADEGQFLNMLLKLINA 75 
225438756   1 MASNQEGQQNQAGRHQEVGHKSLLQSDALYQYILETSVYPREPKPMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINA 80 
255555405   2 ASNNEEQQQNQAGRHQEVGHKSLLQSDALYQYILETSVYPNEPEPMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINA 81 
297802588  13 STNGEDQKQSQNLRHQEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNA 92 
15235213   93 KNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFI 172
224103619  81 KNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFI 160
224056110  81 KNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGLEHKIEFKEGPALPVLDQMIEDGKYHGTYDFI 160
225428851  76 KNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFI 155
225438756  81 KNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPIIEKAGLAHKIDFREGPALPVLDQMIEDGKYHGTFDFI 160
255555405  82 KNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAGVAHKIEFREGPAMPVLDEMVADEKYHGSFDFI 161
297802588  93 KNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFI 172
15235213  173 FVDADKDNYINYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGI 252
224103619 161 FVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGI 240
224056110 161 FVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPADAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGI 240
225428851 156 FVDADKDNYLNYHKRLIDLVKVGGIIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGI 235
225438756 161 FVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYKDFVLELNKALAADPRIEICQLPVGDGI 240
255555405 162 FVDADKDNYLNYHQRLVELVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALPADPRIEICMLPVGDGI 241
297802588 173 FVDADKDNYINYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGI 252
15235213  253 TICRRIS 259
224103619 241 TLCRRIQ 247
224056110 241 TLCRRIK 247
225428851 236 TLCRRLS 242
225438756 241 TLCRRIS 247
255555405 242 TLCRRVK 248
297802588 253 TICRRIS 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap