Conserved Protein Domain Family
PLN02586

?
PLN02586: PLN02586 
probable cinnamyl alcohol dehydrogenase
Statistics
?
PSSM-Id: 166227
View PSSM: PLN02586
Aligned: 6 rows
Threshold Bit Score: 708.953
Threshold Setting Gi: 225431407
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15235022    1 MAKSPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPVVPGHEIVGIATK 80 
224060461   1 MAKSPEVEHPHKAFGWAAKDSSGVLSPFHFSRRDNGVEDVTIKILYCGVCHSDLHAAKNEWGFSRYPLVPGHEIVGIVTK 80 
225431407   1 MAKSPQEEHPQKAFGWAARDPSGILSPFHFSRRENSPDDVTVRVLFCGVCHTDLHSIKNDWGFTRYPIIPGHEFTGIVTK 80 
225431409   1 MVKSPEEEHPQKAFGWAARDPSGTLSPFHFSRRENGDEDVTVKILYCGVCHSDLHSVKNEWGITRYPIVPGHEIVGIVIQ 80 
255578412   1 MAKTPEDEHPQKAFGWAARDISGILSPFHFSRRENTDEDVTVKILYCGVCHSDLHTCRNEWGFSHYPLVPGHEIVGTVTK 80 
297797914   1 MAKSPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYTYYPVVPGHEIVGIATK 80 
15235022   81 VGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIGSDGTKNYGGYSENIVVDQRFVLRFPENLPSDS 160
224060461  81 IGSNVKKFKVDDQVGVGVLVNSCKSCEYCDQDLENYCPKMIFTYNAQNHDGTKTYGGYSDTIVVDQHFVLRIPDSMPADG 160
225431407  81 LGKNVKKFKLGDKVGVGVMVGSCRSCESCKQGLENYCPKMMFAYNSIYHDGTKNYGGYSNMVVVDQHFVLRFPDNLPLAA 160
225431409  81 LGNNVKKFKMGDRVGVGVLVGSCKTCETCQQDLENYCPSMIFTYNSTSQDGTRTYGGYSDIVVVDQRYVLRIPDNMPLDA 160
255578412  81 TGSNVKKFKAGDRVGVGVIIGSCKSCEYCKQDLENYCPKMMFTYNSHGADGTKNYGGYSNMIVVDQHFVVRLPDSLPLDA 160
297797914  81 VGKNVTKFKEGDRVGVGVIAGSCQSCESCDQDLENYCPQMSFTYNAIASDGTKNYGGYSENIVVDQRFVLRFPENLPSDS 160
15235022  161 GAPLLCAGITVYSPMKYYGMTEAGKHLGVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQK 240
224060461 161 AAPLLCAGITVYSPMKYYGMTEPGKHLGIVGLGGLGHVAVKIGKAFGLKVTVISSSSRKESEALDRLGADSFLVSSDPEK 240
225431407 161 GAPLLCAGITVYSPMKYYGMTQAGKHLGVSGLGGLGHVAVKIGKAFGHKVTIISASPNKKDDAIKRLGADAFLLSTDPTK 240
225431409 161 GAPLLCAGITVYSPMKYYGMTEPGKHLGVAGLGGLGHVAVKLGKAFGLKVTVISTSPNKEDEAINKLGADCFLVSTNPEK 240
255578412 161 AAPLLCAGITVYSPMKYYGITEPGKHLGIAGLGGLGHIAVKIGKAFGLKVTVISTSARKENEAITRLGADAFLISSDPGK 240
297797914 161 GAPLLCAGITVYSPMKYYGMTEAGKHLGVAGLGGLGHVAVKIGKAFGLKVTVISSSSKKEEEAINHLGADSFLVTSDPQK 240
15235022  241 MKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMKETQEMLDFCAKHN 320
224060461 241 MKAAFGTMDYIIDTVSAVHALAPLLSLLKTNGKLVTLGLPEKPLELPIFPLVLGRKLVGGSDIGGVKETQEMLDFCAKHN 320
225431407 241 MKAALGTMDYIIDTVAAVHPLGPLLGLLKVNGKLITLGLPEKPLELPIFPLVLGRKLVGGSNIGSTKETQEMLEFCAKHN 320
225431409 241 VQAALGTMDYIIDTVSAIHSLGPLLAMLKLNGKLITVGLPDKPLELPIFPLVMGRKLIGGSDIGGIKETQEMLDFCAKHN 320
255578412 241 MKAAIGTMDYIIDTVSAVHALAPLLSLLKPNGKLITLGLPEKPLELPIFPLVLGRKLVGGSDIGGIKETQEMLDFCAKHN 320
297797914 241 MKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGLKETQEMLDFCAKHN 320
15235022  321 ITADIELIKMDEINTAMERLAKSDVRYRFVIDVANSLSPP 360
224060461 321 ITSDVEVIRMDQINTAMDRLAKSDVRYRFVIDVANSLSQS 360
225431407 321 ITADIEMIRMDYINTAMERLAKSDVRYRFVIDVAGSLSE- 359
225431409 321 ITADIELIQMDYINTAMKRLSKSDVKYRFVIDVANSLSQ- 359
255578412 321 ITADVEVIGMDEINMAMDRLAKSDVKYRFVIDVGNSLSQL 360
297797914 321 ITADIELIKMDEINSAMERLAKSDVRYRFVIDVANSLSPP 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap