Conserved Protein Domain Family
PLN02565

?
PLN02565: PLN02565 
cysteine synthase
Statistics
?
PSSM-Id: 166206
View PSSM: PLN02565
Aligned: 13 rows
Threshold Bit Score: 584.964
Threshold Setting Gi: 115455323
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30683038    1 MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGV 80 
15233613    1 MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGV 80 
115455323   4 SGQSIASDVTALIGNTPLVYLNKVVDGCEAQIAAKLEIMEPCSSVKDRIGYSMITDAEEKGLITPGKSVLIEPTSGNTGI 83 
115489664   1 MGETIAKDVTELIGNTPLVYLNRVTDGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGLITPGKSVLIEPTSGNTGI 80 
225451235   4 EKCFIAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLITPGESVLIEPTSGNTGI 83 
225451237   4 EKCFIAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLITPGESVLIEPTSGNTGI 83 
224125568   4 EKGSIAKDITELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLIKAGESVLIEPTSGNTGI 83 
224130736   4 EKGSIAKDVTELIGKTPLVYLNNVVDGCVARVAAKLEMMEPCSSVKDRIGYSMITDAEEKGLIKPGESVLIEPTSGNTGI 83 
224144420   4 EKGSIAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMIKDAEEKGLIKPGESVLIEPTSGNTGI 83 
224099811   4 EKYEIAKDVTELIGKTPLVYLNNVLDGCVARIAAKLEGMEPCSSVKDRIGYSMIADAEAKGLITPGESVLIEPTSGNTGI 83 
255542380   4 EKSAIAKDVTELVGKTPLVYLNHVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLIKPGESVLIEPTSGNTGI 83 
255552177   4 EKYEIAKDVTELIGNTPLVYLNNVVDGCVARVAAKLEMMEPCSSVKDRIGYSMIADAEAKGLITPGQNVLIEPTSGNTGI 83 
297800722   1 MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGV 80 
30683038   81 GLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYET 160
15233613   81 GLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYET 160
115455323  84 GLAFMAAAKGYKLILTMPASMSMERRIILKAFGAELVLTDPLLGMKGAIQKADELAAKMPNSYILQQFENPANPKIHYET 163
115489664  81 GLAFMAAAKGYRLVLTMPASMSMERRIILKAFGAELILTDPLLGMKGAVQKAEELAAKTNNSFILQQFENPANPKIHYET 160
225451235  84 GLAFMAAAKGYKLIITMPASMSLERRIILRAFGAELVLTDPAKGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYET 163
225451237  84 GLAFMAAAKGYKLIITMPASMSLERRIILRAFGAELVLTDPAKGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYET 163
224125568  84 GLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKGAVQKAEEISAKTPNSYILQQFENPANPKVHYET 163
224130736  84 GLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELILTDPARGINGAVQKAEEILAKTPNAYILQQFENPANPKVHYET 163
224144420  84 GLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELILTDPARGMKGAVQKAEEILAKTPNAYLLQQFENPANPKIHYET 163
224099811  84 GLAFMAAAKGYKLIITMPASMSNERRIILRAFGAELVLTNPAKGMKGAVQKAEEIKAKTPNAYILQQFENPSNPKVHYET 163
255542380  84 GLAFMAAAKGYKLIITMPASMSLERRMVLRAFGAELVLTDPARGMKGAVQKAEEILAKTPNSYILQQFENPANPKIHYET 163
255552177  84 GLAFMAAAKGYRLIITMPASMSLERRIILRAFGAELVLTDPAKGMKGAVQKAEEILAKTPNAYMLQQFENAANPKIHYET 163
297800722  81 GLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYET 160
30683038  161 TGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLI 240
15233613  161 TGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLI 240
115455323 164 TGPEIWKATAGKVDILVSGIGTGGTVTGTGKYLKEQNPEIKIYGVEPTESAILSGGRPGPHKIQGIGAGFVPGVLDVNLL 243
115489664 161 TGPEIWKGTGGKVDGLVSGIGTGGTITGAGRYLREQNPDIKIYGVEPVESAVLSGGKPGPHKIQGIGAGFVPGVLDVDLI 240
225451235 164 TGPEIWRGTGGKVDAFVSGIGTGGTITGAGKFLKEQNSDIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLL 243
225451237 164 TGPEIWRGTGGKVDAFVSGIGTGGTITGAGKFLKEQNSDIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVNLL 243
224125568 164 TGPEIWKGSGGKVDAFVSGIGTGGTITGAGKYLKEQNPDIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLNVDLL 243
224130736 164 TGPEMWKGSGGKVDAFVSGIGTGGTITGAAKYLKEQNPDIKIYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVGLL 243
224144420 164 TGPEMWKGSGGKVDAFVSGIGTGGTITGAAKYLKEQNPDIKIYGVEPVESAVLSGGKPGPHKIQGIGAGFIPAVLDVGLL 243
224099811 164 TGPEIWKGSGGKVDALVSGIGTGGTITGAGKYLKEQNPNIKLYGVEPVESPILSGGKPGPHKIQGIGAGFVPGVLDVKIV 243
255542380 164 TGPEIWKGSGGKVDFFVSGIGTGGTVTGAGGYLREQNPDIKLIGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVSLL 243
255552177 164 TGPEIWKGSGGKIDALVSGIGTGGTITGAGKYLKEQNPNIKLFGVEPVESPVLSGGKPGPHKIQGIGAGFVPGVLEVDII 243
297800722 161 TGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLI 240
30683038  241 DEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTF 320
15233613  241 DEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTF 320
115455323 244 DEVVQVSSDEAISMAKQLALKEGLLVGISSGAAAVAAIRVAQRPENKGKLVVVVFPSFGERYLSSVLFESIKREAENMVF 323
115489664 241 NETVQVSSDEAIEMAKALALKEGLLVGISSGAAAAAAVRLAQRPENEGKLFVVVFPSFGERYLSSVLFQSIKKEAENMVV 320
225451235 244 DEVVQVSSEEAIETAKLLALKEGLLVGISSGGAAAAAIKLAKRPENAGKLIVVVFPSFGERYLSSVLFDSVKREAENMLF 323
225451237 244 DEVVQVSSEEAIETAKLLALKEGLLVGISSGGAAAAAIKLAKRPENAGKLIVVVFPSFGERYLSSVLFDSVKREAENMLF 323
224125568 244 DETVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAIKIAKRPENAGKLIVAIFPSFGERYLSSVLFESVKKEAENMVF 323
224130736 244 DETVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAIEIAKRPENAGKLIVVIFPSFGERYLSTVLFESVRKEAENMVF 323
224144420 244 DETVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAIEIAKRPENAGKLIIVIFPSFGERYLSTVLFESVRKEAENMVF 323
224099811 244 DEVVQISSDEAIETAKLLALKEGLLVGISSGAAAAAAVKIAKRPENAGKLIVVVFPSFGERYLSSVLFDSVKREAESMKF 323
255542380 244 DEVVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAIKIARRPENAGKLIVVIFPSFGERYLSSVLFESVKREAESMVF 323
255552177 244 DEVIQVSSQEAIETAKLVALKEGLLVGISCGAATAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRREAESMTY 323
297800722 241 DEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAESMTF 320
30683038  321 EA 322
15233613  321 EA 322
115455323 324 EP 325
115489664 321 E- 321
225451235 324 EP 325
225451237 324 EP 325
224125568 324 EP 325
224130736 324 VP 325
224144420 324 VP 325
224099811 324 EP 325
255542380 324 EP 325
255552177 324 EP 325
297800722 321 EA 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap