Conserved Protein Domain Family
PLN02558

?
PLN02558: PLN02558 
CDP-diacylglycerol-glycerol-3-phosphate/ 3-phosphatidyltransferase
Statistics
?
PSSM-Id: 166199
View PSSM: PLN02558
Aligned: 4 rows
Threshold Bit Score: 344.321
Threshold Setting Gi: 224098148
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224098148   1 MQNHDSKLLTLPTILTLGRVAAVPLLVATFYVDSWWARTATTSIFVAAAITDWLDGYLARKMKLGTVFGAFLDPVADKLM 80 
15233163   33 PTQLSSKVITLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGSEFGAFLDPVADKLM 112
224112921  36 QQQQHSKFLTLPTVLTLGRVAAVPLLVATFYADSWWGRTATTSIFIVAAITDWLDGYLARKMKLGTAFGAFLDPVADKLM 115
297816800  33 PTQLSSKVITLPTVLTLGRVAAVPILVATFYVDCWWGKTATTSIFIAAAITDWLDGYIARKMRLGSAFGAFLDPVADKLM 112
224098148  81 VAAALILLCSRPLEVAMFREVPWLFTVPAIAIIGREITMSAVREWAASQNTRLLEAVAVNNLGKWKTATQMISLTILLAT 160
15233163  113 VAATLILLCTKPMVAVVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALTILLAS 192
224112921 116 VAAALILLCSRPLEVALSGEVPWLFTVPATSIIGREITMSAVREWAASRNSKLLEAVAVNNLGKWKTATQMISLTILLAA 195
297816800 113 VAATLILLCTKPMVAVVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALTLLLAS 192
224098148 161 RDSSLGGpgiLVPSGVLLLYISAGLSVWSLAIYMSKIWKVLLK 203
15233163  193 RDSSFER---LLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLLK 232
224112921 196 RDSSLEGpgiLVPSGVILLYISAGLSIWSLAVYVSKIWKVLLK 238
297816800 193 RDSSFER---LLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLLK 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap