Conserved Protein Domain Family
PLN02514

?
PLN02514: PLN02514 
cinnamyl-alcohol dehydrogenase
Statistics
?
PSSM-Id: 166155
View PSSM: PLN02514
Aligned: 12 rows
Threshold Bit Score: 635.298
Threshold Setting Gi: 297830602
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15230382    1 MGSVEAgEKKALGWAARDPSGVLSPYSYTLRSTGADDVYIKVICCGICHTDIHQIKNDLGMSNYPMVPGHEVVGEVLEVG 80 
15235295    1 MGIMEA-ERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVG 79 
115444705   1 MGSLAA-EKTVTGWAARDASGHLTPYNYTLRKTGPEDVVVKVLYCGICHTDIHQAKNHLGASKYPMVPGHEVVGEVVEVG 79 
79326288    1 MGIMEA-ERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVG 79 
225438841   1 -----MeGRRVVGWAARDASGLLSPYSFTLRKTGPEDVVIKVLYCGMDHTDLHQMRNEVHSTNYPLVPGHEVVGEVVELG 75 
225428914   1 MRSLGT-EKTTIGWAARDPSGALSPYTYTLRNTGPEDVVIKVTYCGICHSDLHLIKNHQGISHYPMVPGHEVVGEVVEVG 79 
225428916   1 MGSLET-EKTIIGWAARDPSGVLSPYTYTLRNTGPEDVLIKVTYCGICHTDLHQIKNDLGMSHYPMVPGHEVVGEVVEVG 79 
224105617   1 MGSLET-ERKIVGWAATDSTGHLAPYTYSLRDTGPEDVFIKVISCGVCHTDIHQIKNDLGMSHYPMVPGHEVVGEVVEVG 79 
255555277   1 MGSLET-ERTIVGWAARDPSGILSPYTYTLRNTGSEDVVLKVIYCGICHTDLHQAKNDLGMSRYPMVPGHEVVGEVVEVG 79 
255567901   1 -----MeGKKAIGWAARDSSGHLSPYSFNLRKTGAEDVVLKVLFSGVDHTDLHQVRGEIGYTNYPLVPGHEVVGEVVELG 75 
297830602   1 MGSEGG-EKKALGWAARDPSGVLAPYSYTLRSTGADDVYIKVICCGICHTDIHQIKNDLGMSNYPMVPGHEVVGEVVEVG 79 
297798484   1 MGIMEA-ERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVG 79 
15230382   81 SDVSKFTVGDVVGVGVVVGCCGSCKPCSSELEQYCNKRIWSYNDVYTDGKPTQGGFADTMIVNQKFVVKIPEGMAVEQAA 160
15235295   80 SDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAA 159
115444705  80 PEVTKYSAGDVVGVGVIVGCCRECHPCKANVEQYCNKRIWSYNDVYTDGRPTQGGFASAMVVDQKFVVKIPAGLAPEQAA 159
79326288   80 SDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAA 159
225438841  76 SEVKKYRVGDMVGVGCMVGSCGRCLSCNSNIEQYCNNRIFTYNGIYKDGRPTQGGFCSAMIVHQKFVVRIPEKLSPEQAA 155
225428914  80 SDVRKFRVGDCVGVGLLVGCCGICRPCKSEMEQYCNQVIWSYNHVYTDGKPTQGGFARSMIVDQKFAVKIPDGMAPEQAA 159
225428916  80 SDVSKVRVGDCVGVGVIVGCCRSCRPCQSDIEQYCSKKIWSYNDVYTDGKPTQGGFAESMIVDQKFVLKIPDGMAPEQAA 159
224105617  80 SDVTKFKVGDVVGVGVIVGSCKNCHPCKSEIEQYCNKKIWSYNDVYTDGKPTQGGFAESMVVDQKFVVRIPDGMSPEQAA 159
255555277  80 SGVTKFRVGDTVGVGVLVGCCRNCMPCNKDIEQYCNKKIWSYNDVYSDGKPTQGGFAQSMVVDQKFVVKIPDGMAPEQAA 159
255567901  76 QEVRKFEVGDIVGIGCIIWSCGECPSCKSKMEQYCDKRIPTYNAIDRDGSITQGGYSSAMVVDQRFVVRIPDKLAPEQAA 155
297830602  80 SDVSKFTVGDVVGVGVIVGCCGSCKPCSSELEQYCNKRIWSYNDVYTDGKPTQGGFADTMIVNQKFVVKIPEGMAVEQAA 159
297798484  80 SDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYIDGQPTQGGFAKATVVHQKFVVKIPEGMAAEQAA 159
15230382  161 PLLCAGVTVYSPLSHFGLMASGLKGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKKEEAIEHLGADDYVVSSDPAEMQ 240
15235295  160 PLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMS 239
115444705 160 PLLCAGLTVYSPLKHFGLMSPGLRGGVLGLGGVGHMGVKVAKSMGHHVTVISSSARKRGEAMDDLGADAYLVSSDAAAMA 239
79326288  160 PLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMS 239
225438841 156 PLLCAGVTAYSPLRQFMGSGKVLNAGILGLGGVGHLGVKIAKAMGHHVTVISSSDKKREEALQHLGADAFLVSSNAAEME 235
225428914 160 PLLCAGVTAYSPLSHLGLKKSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDRKREEAMDHLGADDYLISSDSTRMQ 239
225428916 160 PLLCAGVTVYSPLSHFGLKKSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDRKREEAMDHLGADDYLVSSDSTRMQ 239
224105617 160 PLLCAGLTVYSPLKHFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKREEAMEHLGADEYLVSSDVESMQ 239
255555277 160 PLLCAGVTVYSPLSHFGLKKSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKRVEALDHLGADEYLVSSDETSMQ 239
255567901 156 PLLCAGVTAYSPLKEFNKSNKALGAGIMGLGGVGHLAVLIAKAMGHHVTVISSSERKREEALEHLRADAFLVSSSAAEMK 235
297830602 160 PLLCAGVTVYSPLSHFGLMASGLKGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKKEEAMEHLGADDYAVSSDPAEMQ 239
297798484 160 PLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMS 239
15230382  241 RLADSLDYIIDTVPVFHPLDPYLACLKLDGKLILMGVINTPLQFVTPLVILGRKVISGSFIGSIKETEEVLAFCKEKGLT 320
15235295  240 ELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITGSFIGSMKETEEMLEFCKEKGLS 319
115444705 240 AAGDSLDYIIDTVPVHHPLEPYLALLKLDGKLILMGVINQPLSFISPMVMLGRKAITGSFIGSMAETEEVLNFCVDKGLT 319
79326288  240 ELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGEKVITGSFIGSMKETEEMLEFCKEKGLS 319
225438841 236 EAANNLDYILDTVPALHPLQSYLSLLKVDGKLFLVGVSPKPLQFDATDLILGKKNITGSFIGSMEETQEILDFWAEKNLT 315
225428914 240 KAADSLDYIIDTVPVFHPLELYLSLLKLDGKLILLGIINTPLQFANPMVMLGRKSITGSFIGSMKETEEVLEFCKEKGVT 319
225428916 240 EAADSLDYIIDTVPVFHPLEPYLSLLKLDGKLILMGVINTPLQFVTPMVMLGRKIITGSFIGSMKETEEMLEFCKENGLT 319
224105617 240 KAADQLDYIIDTVPVVHPLEPYLSLLKLDGKLILMGVINAPLQFVTPMVMLGRKSITGSFIGSMKETEEMLEFCKEKGLA 319
255555277 240 QATDSLDYIIDTVPANHPLEPYLSLLKLDGKLILLGVINTPLQFVSPMLMLGRKIISGSFIGSIKETEEMLEFCKENGLT 319
255567901 236 NAANSLDYILDTVPAMHSLNSYLSLLKVDGKIIIVGAAPEPLQFTASDLILGKKNISGSFVGSIEDTEEILEFWAEKGLT 315
297830602 240 RLADSLDYIIDTVPVFHPLEPYLACLKLDGKLILMGVINTPLQFLTPVVILGRKVISGSFIGSIKETEEVLAFCKEKGLT 319
297798484 240 ELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITGSFIGSMKETEEMLEFCKEKGLS 319
15230382  321 STIETVKIDELNIAFERLRKNDVRYRFVVDVAGSNLVE 358
15235295  320 SIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNLDA 357
115444705 320 SQIEVVKMDYVNQALERLERNDVRYRFVVDVAGSNIDD 357
79326288  320 SIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNLDA 357
225438841 316 SMIEIVKMDYVNKAFERMERSDVRYRFVVDVAGSNLE- 352
225428914 320 SMIEMVKMDYVNTAFERLEKNDVRYRFVVDVAGSKLDQ 357
225428916 320 SMIEMVKMDYVNTALERLEKNDVRYRFVVDVAGSKLDQ 357
224105617 320 SMIEVIKMDYINTAFERLEKNDVRYRFVVDVAGSKLIP 357
255555277 320 SMIEVIKMDYVNTAFERLEKNDVRYRFVVDVAGSKLEP 357
255567901 316 SMIETVKMDYVNKAFERMERNDVRYRFVLDVAGSYPE- 352
297830602 320 STIETVKIDELNTAFERLSKNDVRYRFVVDVAGSNLVE 357
297798484 320 SIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNFDA 357
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap