Conserved Protein Domain Family
PLN02493

?
PLN02493: PLN02493 
probable peroxisomal (S)-2-hydroxy-acid oxidase
Statistics
?
PSSM-Id: 166134
View PSSM: PLN02493
Aligned: 5 rows
Threshold Bit Score: 697.635
Threshold Setting Gi: 145361806
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15231850    1 MEITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAM 80 
15229497    1 MEITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMATTVLGFKISMPIMVAPTAF 80 
30683149    1 MEITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAM 80 
145361806   1 MEITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAM 80 
297829994   1 MEITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAM 80 
15231850   81 QKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPR 160
15229497   81 QKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRKVVEQLVRRAEKAGFKAIALTVDTPR 160
30683149   81 QKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPR 160
145361806  81 QKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPR 160
297829994  81 QKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPR 160
15231850  161 LGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARI 240
15229497  161 LGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDIQWLQTITNMPILVKGVLTGEDARI 240
30683149  161 LGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARI 240
145361806 161 LGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDGEI 240
297829994 161 LGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARI 240
15231850  241 AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGE 320
15229497  241 AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRVPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFALAAEGE 320
30683149  241 AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGE 320
145361806 241 AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGE 320
297829994 241 AIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGE 320
15231850  321 AGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDTPRPSARL 367
15229497  321 AGVKKVLQMLRDEFELTMALSGCRSLSEITRNHIVTEWDTPRHLPRL 367
30683149  321 AGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDTPRPSARL 367
145361806 321 AGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDTPRPSARL 367
297829994 321 AGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDTPRPSARL 367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap