Conserved Protein Domain Family
PLN02473

?
PLN02473: PLN02473 
glutathione S-transferase
Statistics
?
PSSM-Id: 166114
View PSSM: PLN02473
Aligned: 4 rows
Threshold Bit Score: 440.58
Threshold Setting Gi: 297828794
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15237931    1 MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFAD 80 
15228488    1 MVVKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYAD 80 
297807743   1 MVVKLYGQVTAACPQRVLLCFLEKEIEFEIIHIDLDTLEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKYAD 80 
297828794   1 MVVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDKLEQKKPEHLLRQPFGQVPAIEDGDLKLFESRAIARYYATKYAD 80 
15237931   81 QGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLIIKPRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGE 160
15228488   81 QGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGD 160
297807743  81 QGTNLLGKSLEHRAIVDQWADVETHYFNALAHPIVINLIIKPRLGEKCDVVLVEELKVKLGVVLDIYNNRLSSNRFLAGE 160
297828794  81 QGTDLLGKTLEKRAIVDQWVEVENNYFYAVALPLVINIVFKPMFGEPIDVALVEELKVKFDKVLDVYENRLATNRYLGGD 160
15237931  161 EFTMADLTHMPAMGYLMSITDINQMVKARGSFNRWWEEISDRPSWKKLMVLAGH 214
15228488  161 EFTLADLSHMPGMRYIMNETSLSGLVTSRENLNRWWNEISARPAWKKLMELAAY 214
297807743 161 EFTMADLTHMPAMGYLMSITDINQMVKARGSFNRWWEEISDRPSWKKLMVLAGH 214
297828794 161 EFTLADLTHMPGMRYIMNETSLSGLVTSRENLNRWWNEISARPAWKKLMELAAY 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap