Conserved Protein Domain Family
PLN02463

?
PLN02463: PLN02463 
lycopene beta cyclase
Statistics
?
PSSM-Id: 178082
View PSSM: PLN02463
Aligned: 18 rows
Threshold Bit Score: 703.396
Threshold Setting Gi: 302851559
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302775756   1 MLLELVPERKK-ESLSYELPLFNPS-RKGPLDLVVVGGGPAGLAVAARVSAAGLSVCCIDPCPLSIWPNNYGVWVDEFEA 78 
168041612   4 ALLELVPPQMStKLLNYELLRFDTA-KRKAVGLVVVGAGPAGLAVAQRVSKEGVSVCVVDPAPQSVWPNNYGVWVDEFED 82 
168019925  73 SLLELVPPHVK-KNLNYELLRFDTL-KRKAVDLVVVGAGPAGLAVAQRVSGEGVDVCVVDPAPQSVWPNNYGVWVDEFED 150
145356546  73 ESEESRTPLPE----TLPNVRWGTS-ASEAYDLVIVGCGPAGLTAADEASKRGLRVALMDPSPLAPWMNNYGVWCDEFKS 147
242064318  44 ALRSLAPPTRP-ELLSLDLPRYDPA-RARPVDLAVVGGGPAGLAVAQRVAEAGLSVCAIDPSPAVVWPNNYGVWVDEFEA 121
225464892  53 SFLDLKPESEA-ELLDFDLRWLDSS-CKSCLDVIIIGAGPAGLRLAEQVSRYGIHVCCIDPSPLSMWPNNYGVWVDEFEG 130
224104899  51 SFLDLKPESKP-EFLDFDLSWFDPAdRPRCFDVIIIGAGPAGLRLAEQVSGYGIKVCCVDPSPLSMWPNNYGVWVDEFES 129
224132290  51 SFLDLKPLSKP-ESLDFDLSWFDPAdRHRCFDVIVIGTGPAGLRLAEQVSRYGVKVCCVDPSPLSMWPNNYGVWVDEFES 129
255565695  51 SFLDLQPESKS-ELLDFDLSRFDPS-SKSRFDVIIIGTGPAGLRLAEQVSRYGIKVCCVDPSPLSMWPNNYGVWVDEFED 128
302756175   1 MLLELVPERKK-ESLSYELPLFNPS-RKGPLDLVVVGGGPAGLAVAARVSAAGLSVCCIDPCPLSIWPNNYGVWVDEFEA 78 
302775756  79 LDLLDCLDHTWASAVVYIDD--GVKKFLQRPYGRVNRKRLKAKMTEQCIANGVQFLATKVKNVVHDREK-SRVACEDGTC 155
168041612  83 LDLLDCLDYTWASAVVYLDD--EKKKTLERPYGRVNRTRLKSKMLEACIANGVQFHQAKVKDVNHNLSE-SSVTCEDGTL 159
168019925 151 LDLLDCLDYTWGSAVVYLDD--ARKKTLERPYGRVNRTRLKSKMLEACIANGVQFHQAKVKDVDHNVSK-SIVTCEDGTM 227
145356546 148 LGFDDCYRAVWNKARVIIDDgdADGKMLDRAYAQVDRKKLKQKLIARSVTQGVEFGIAAVDSCDNSDPNhSVVTLSDGRK 227
242064318 122 MGLSHCLDTVWPSASVFIGD--GRAKSLDRPYARVARRKLKSTMMDRCVANGVVFHQAKVAKAVHYDAS-SLLICDDGVA 198
225464892 131 LGLEDCLDKTWPMTCVRIDD--HRTKYLDRAYGRVSRKRLKMKLLEICAAYGVQFHKAKVWKVEHQEFE-SLVECDDGSK 207
224104899 130 LGLVDCLDKTWPMTCVHIDD--DTTKYLDRPYGRVGRKEVKTKLLENCASNGVRFHKAKVLNLEHKEFE-SSIVCDDGIE 206
224132290 130 LGLVDCLDKTWPMTCVYIDD--DKTKYLDRPYARVGRKEFKTKLLENCASNGVRFHKAKVWKVKHEEFE-SSIVCDDGIE 206
255565695 129 LGFVDCLNKTWPMTCVFIDD--HKTKYLDRPYGRVCRKKLKTKLMENCVSKGVQFHKAKVWEVGHEEFE-SSVVCDDGNE 205
302756175  79 LDLLDCLDHTWASAVVYIDD--GVKKFLQRPYGRVNRKRLKAKMTEQCIANGVQFLATKVKNVVHDREK-SRVACEDGTC 155
302775756 156 LESALVLDATGFSKCLVQYDQPFNPGYQVAYGIVAEVDSHPFDLDKMVFMDWRDSHLAGNPEMIRGNKKLPTFLYAMPFS 235
168041612 160 IEAAVVLDATGHSRRLVKYDKPFNPGYQIAYGIVAEVDSHPFDVDKMLFMDWRDSHLRGSRELMEGNLKLPTFLYAMPFS 239
168019925 228 IEAAVVLDATGHSRRLVQYDKPFNPGYQIAYGIVAEVDSHPFDVDKMLFMDWRDSHLHGDKLLMDGNLELPTFLYAMPFS 307
145356546 228 VYAKMVLDATGHSRKLVDFDRDFTPGYQAAFGIVCTVEKHDFPLDTMLFMDWRDEHLS--PEFKRANDRLPTFLYAMPFS 305
242064318 199 VPASVVLDATGFSRCLVQYDKPYNPGYQVAYGILAEVDGHPFDIDKMLFMDWRDSHLPEGTEIRERNRRIPTFLYAMPFS 278
225464892 208 LRANLVVDASGFASTFIEYDKPRNHGYQIAHGILAEVDSHPFDLDKMLLMDWRDSHLGNEPYIRAGNSSLPTFLYAMPFN 287
224104899 207 LKASLVVDASGFASTFTEYDKPRNHGYQIAHGILAEVDCHPFDLDKMVLMDWRDSHMGNEPYLRANNSKIPTFLYAMPFD 286
224132290 207 LRASLVVDASGFASTFTEYDKPRNHGYQIAHGILAEVDYHPFDLDKMVLMDWRDSHLGNEPCLRANNSKLPTFLYAMPFD 286
255565695 206 LKASLIVDASGFTSTFIEYDKPRNHGYQIAHGILAEVDCHPFDLDKMVLMDWRDSHMGNEPYLRASNSRFPTFLYAMPFD 285
302756175 156 LESALVLDATGFSKCLVQYDQPFNPGYQVAYGIVAEVDSHPFDLDKMVFMDWRDSHLAGNPEMIRGNKKLPTFLYAMPFS 235
302775756 236 STKIFLEETSLVARPGVPLKEIQKRMEVRLRHLGIHVKSIEEDEVCVIPMGGVLPVIPQRVLGIGGTAGLVHPSTGYMVA 315
168041612 240 ANHIFLEETSLVARPGVPMDVIQKRMELRLKHLGICVRSIEEDEKCVIPMGGVLPVIPQRVLGIGGTAGMVHPSTGYMVA 319
168019925 308 ANHIFLEETSLVARPGVPMDVIQKRMELRLKHLGIHVRSIEEDEKCVIPMGGVLPVIPQRVLGIGGTAGMVHPSTGYMVA 387
145356546 306 ETEVFLEETSLVARPGLEFDDLKLKLKERLDYLGVKVTKVHEEEYCLIPMGGVLPTFPQRTLGIGGTAGMVHPSTGFMVA 385
242064318 279 PTRIFLEETSLVARPGLAMDDIQERMAARLRHLGIRVRSVEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVA 358
225464892 288 SNLIFLEETSLVSRPMLSYKEVKRRMVARLRHLGIRVRRVIEDEKCLIPMGGPLPQIPQSVMAIGGTAGLVHPSTGYMVA 367
224104899 287 SNLVFLEETSLVSRPLLSYMEVKNRMVARLRHLGIRVKTVIENEKCVIPMGGPRPKIPQSVMAIGGTSGVVHPSTGYTVA 366
224132290 287 SNLVFLEETSLVSKPLLSYMEVKNRMVARLRHLGIRVKNVIEEEKCLIPMGGPLPRIPQSVMAIGGTSGVVHPSTGYMVA 366
255565695 286 SNLIFLEETSLVSRPVLPYMEVKRRMVARLRHLGIRVRRVIEDEKCLIPMGGPLPRIPQTVMAIGGNSGVVHPSTGYMVA 365
302756175 236 STKIFLEETSLVARPGVPLKEIQKRMEVRLRHLGIHVKSIEEDEVCVIPMGGVLPVIPQRVLGIGGTAGLVHPSTGYMVA 315
302775756 316 RTLAAAPVVADAIVRQLGSSR----------------SSSsVTllPDDLSAEVWADLWPIERKRQREFFCFGMDILLKLD 379
168041612 320 RTLAAAPMLAESVIQRLGGSA----------------TSG-LP--CDELAAGVWADLWPLNRQRQRAFFCFGMDVLLKLD 380
168019925 388 RTLAAAPLLAESVIKSLGDNA----------------GPS-----GDELAAGVWADLWPLERQQQRAFFCFGMEVLLKLD 446
145356546 386 KTMLCVRTLVGTLDEALKAGKrgditgaleaaeaaqmNNGkFD--ADATAALVWNSIWPENDLRMRTFMCFGMETLMQLD 463
242064318 359 RTLATAPIVADAIVRFLDTGN----------------GMGgLA--GDALSAEVWKQLWPANRRRQREFFCFGMDILLKLD 420
225464892 368 KTMALAPVLAETIRECLGSSR----------------M---IR--GKPLHHRVWNGLWPSERRFTREFYSFGMETLLKLD 426
224104899 367 RTMALAPIVADAIVECLGSTR----------------M---IR--GRPLHHRVWNGLWPLERRCTREFYSFGMETLLKLD 425
224132290 367 RTMALAPIVAGAIVECLGSTR----------------M---IR--GRPLHHRVWNGLWPLERRCTREFYSFGMETLLKLD 425
255565695 366 RTMALAPILADVIAECLGSTR----------------M---IR--GRPLYDRVWKGLWPLDKKCTREYYSFGMETLLKLD 424
302756175 316 RTLAAAPVVADAIVRQLGSSR----------------SSSsVThlPDDLSAEVWADLWPIERKRQREFFCFGMDILLKLD 379
302775756 380 LYATRRFFSAFFDLEPRLWQGFLSSRLYLPELVAFGLSLFAHAPAKSRLEIMAKGTPALVTMVNNLITTKS 450
168041612 381 LAGTRRFFDAFFDLEPHHWQGFLSSRLYFMELIGFGLSLFKHATNQARAEIMAIGAVPLFRLILEISQMKP 451
168019925 447 LAGTRRFFDAFFDLEAHLWQGFLSSRLYFIELIGFGLSLFKHATNHARAEIVASGTVPLAKLILEVAQMRP 517
145356546 464 IDGTRQFFDTFFDLPKDVWAGFLSWRIQPVGLLSLGVNLFALFSNYMRVNFVKSALPFMGSFFAN------ 528
242064318 421 LEGTRRFFDAFFDLEPHYWHGFLSSRLFLPELLMFGLALFGNASNTSRLEIMAKGTVPLGKMIGNLIQDRD 491
225464892 427 LNGTRGFFDAFFDLDPYYWQGFLSSRLSPRELALLSLSLFGRASNPSRFDIITKCPAPLVKMMGKLAFETI 497
224104899 426 LNGTRRFFDAFFDLDPYYWQGFLSSRLSLRELLFLSLSLFSNASNPSRFDIVTKCPVPLVKMMGNLALETI 496
224132290 426 LKGTRRFFDAFFDLDPYYWQGFLSSSLSLGELLLLSFSLFRNASNPSRFDIVTKCPVPLARMVGNLAHEAI 496
255565695 425 LKGTRNFFNAFFDLDPYYWEGFLSSRLSLGQLALLSLSLFGNASNSSRFDIVTKCPLPLVRMMNNLALETI 495
302756175 380 LYATRRFFSAFFDLEPRLWQGFLSSRLYLPELVAFGLSLFAHAPAKSRLEIMAKGTPALVTMVNNLITTKS 450
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap