Conserved Protein Domain Family
PLN02455

?
PLN02455: PLN02455 
fructose-bisphosphate aldolase
Statistics
?
PSSM-Id: 178074
View PSSM: PLN02455
Aligned: 34 rows
Threshold Bit Score: 678.395
Threshold Setting Gi: 115463789
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18414312    1 MSCFKSKFAGksyfrrtfhssiiqfhpqlsiliwhrrysiirtyELIANAAYIGTPGKGILAADESTGTIGKRFVSINVE 80 
115468886   1 MSAFVGKYAD----------------------------------ELIKTAKYIATPGKGILAADESTGTIGKRLASINVE 46 
168014521   1 MSAYWGKYAD----------------------------------ELIRTAKYVATPGKGILAADESTTTIDARLSSINVE 46 
168025970   1 MSAYWGKYAD----------------------------------ELIRTAKFIGTPGKGILAADESTSTIGTRLQSINVE 46 
168032302   1 MAPYSGKYAE----------------------------------ELQATAKYVATPGKGILAADESTGTIGKRLSSIKVE 46 
168029057   1 MAPYSGKYAE----------------------------------ELQATAKYIATPGKGILAADESTGTIGKRLSSIKVE 46 
255557204   1 MSAFVGKYAE----------------------------------ELIKTAKYIATPGKGILAADESTGTIGKRLASINVE 46 
242093550   1 MSAFVGKYTD----------------------------------ELIKTAKYLATPGKGILASDESTGTIGKRLSSINLE 46 
302793476   1 MAAVAGKYAD----------------------------------ELIKNAKYIATPGKGILAADESTGTIGKRLASIKVE 46 
302774012   1 MAAVVGKYAD----------------------------------ELIKNAKYIATPGKGILAADESTGTIGKRLASIKVE 46 
18414312   81 NVESNRRALRELLFTTPGALQYISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTTTGLDGL 160
115468886  47 NVEPNRQALRELLFTTPGAFQYLSGVILFEETLYQSTAAGTPFVDVLKAGGVVPGIKVDKGTVDIAGTNGETTTQGLDSL 126
168014521  47 NTEANRQALREMLFTAPGVHQYLSGVLMLEETLYQKTVAGKPFVKLLKEGGVMTGIKVDTGTIPLAGTNDETMTQGHDGL 126
168025970  47 NTEANRQALREMLFTAPGIHQFLSGVIMYEETLYQKTLAGKPFVKLLEEMGVMTGIKVDTGVVPLAGTNGETTTQGHDGL 126
168032302  47 NVEANRQALRELLFTTPGVGEYLSGVILFEETLYQKTSDGKPFVDVMKENGIIPGIKVDKGTIELWGTNGETTTQGFDDL 126
168029057  47 NVEANRQALRELLFTTPGVGEFLSGVILFEETLYQKTADGKPFVDVMKENGIIPGIKVDKGTINLWGTNGETTTQGFDDL 126
255557204  47 NVESNRQALRELLFTSPNALSHLSGVILFEETLYQKTSDGKPFVEVLQENNVVPGIKVDKGTVELAGTNGETTTQGFDSL 126
242093550  47 NVESNRQALRELLFTAPGVFDYLSGVILFEETLYQKTSDGTPFVDVIRAAGAVPGIKVDKGTVEIAGTNGETAAQGLDSL 126
302793476  47 NVESNRQALRELLFTAPGALQYLSGVILFEETLYQKTAAGKPFVDVLLENGVLPGIKVDKGTVPIAGTNGETTTQGLDGL 126
302774012  47 NVESNRQALRELLFTAPGALQYLSGVILFEETLYQKTAAGKPFVDVLLENGVLPGIKVDKGTVPIAGTNGETTTQGLDGL 126
18414312  161 GDRCKKYYEAGARFAKWRAVLKIGNN-EPSELAIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDIEKCAYVTERVL 239
115468886 127 GARCAKYYEAGARFAKWRAVLKIGAAgEPSELAVKQNAEGLARYALICQENGLVPIVEPEILTDGAHDIKTCAAVTERVL 206
168014521 127 GARCKKYYDAGARFAKWRAVLKIGHT-EPSELSVQQNAQGLARYAILCQENGLVPIVEPEVISDGTHDIRKCAEVTERVL 205
168025970 127 GARCKKYYEAGARFAKWRAVLKIGHT-EPSELGIQQNAQGLARYAILCQENGLVPIVEPEVLSDGTHDIRKCAEVTERVL 205
168032302 127 HKRCAAYYNAGARFAKWRAVLKIGAL-EPTELAIQQNAQGLARYAIICQENGLVPIVEPEILVDGLHSIEKCAEVTEKVL 205
168029057 127 HKRCAAYYDAGARFAKWRAVLKIGEL-EPTELAIQQNAQGLARYAIICQENGLVPIVEPEILVDGSHSIDKCAEVTEKVL 205
255557204 127 GARCQQYYKAGARFAKWRAVLKIGPT-EPSELAIQQNAQGLARYAIICQENGLVPIVEPEILTDGPHDIKKCAAMTEIVL 205
242093550 127 GARCAKYYAAGARFAKWRAVLKVGPA-EPSELAVRQNAEGLARYALICQEYGLVPIVEPEILTDGGHDIKTCAAVTERVL 205
302793476 127 AGRCAEYYKAGARFAKWRAVLNIGPS-QPSELGIQENAQGLARYAMICQENGLVPIVEPEILVDGSHDLKTCAKVTEVVL 205
302774012 127 AGRCAEYYKAGARFAKWRAVLNIGPS-QPSELGIQENAQGLARYAMICQENGLVPIVEPEILVDGPHDLKTCAKVTEVVL 205
18414312  240 AACYKALSDHHVILEGTLLKPNMVTPGSDSgSKVKPEVIAKHTVRALQRTVPAAVPAVVFLSGGQSEEEATVNLNAINQL 319
115468886 207 AAVYKSLNDHKVLLEGTLLKPNMVTPGSDS-PKVGAEVIGEYTVAALRRTVPPAVPGIVFLSGGQSEEEASQNLNAMNKL 285
168014521 206 SACYKALNDQHVLLEGTLLKPNMVTSGSDA-PKVSSDIVAKFTVRCLQRTVPPAVPGIMFLSGGQSEEEATLNLNAMNAL 284
168025970 206 AACYKALNDQHVLLEGTLLKPNMVTPGSEA-PKVSCDIIAKFTVRALQRTVPPAVPAVMFLSGGQSEEEATVNLNSMNAL 284
168032302 206 AACYKALNDQNVLLEGTLLKPNMVTPGSDA-EKVSPEVVAQYTVRTLQRTVPPAVPGIVFLSGGQSEEEATRNLNAMNAL 284
168029057 206 AACYKALNDQHVLLEGTLLKPNMVTPGSDA-EKVAPEVVAKYTVRTLQRTVPPAVPGIVFLSGGQSEEEATQNLNAMNAL 284
255557204 206 AAVYKALNDQHVLLEGTLLKPNMVTPGSDS-PKVTPEMIAEYTVTALRRTVPPAVPGIVFLSGGQSEEEATLNLNAMNKL 284
242093550 206 AAVYKSLNDHKVLLEGTLLKTNMVTPGSDS-PKVGAEVIGEYTVAALRRTVPPAVPGVVFLSGGQSEEEATQNLDAMNKL 284
302793476 206 AAVYKALSDHHVLLEGTLLKPNMVTHGSEA-PKASAQEIAEATVLALRRTVPAAVPGIMFLSGGQSEVEATKNLDAMNKL 284
302774012 206 AAVYKALSDHHVLLEGTLLKPNMVTHGSEA-PKVSAQEIAEATVLALRRTVPAAVPGIMFLSGGQSEVEATKNLDAMNKL 284
18414312  320 KGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKANSEATLGGYKGDAQLGEGASESLHVKDYKY 393
115468886 286 EVLKPWTLTFSFGRALQQSTIKKWGGKKENVAAAQAAFLARCKANSEATLGKY-GGAAGDAATSESLYVKGYTY 358
168014521 285 QTLKPWTLSFSYGRALQESVLKTWAGEKKNWVAAQRVLYNRAKANSEAVLGKYRGDSGGEAG---NLFVRDYKY 355
168025970 285 QTLKPWTLSFSYGRALQSSVLKTWGGEKKNWVAAQRVLYNRAKANSEAVLGKYKGDSGGDSG---NLFVKDYKY 355
168032302 285 KTTKPWTLSFSFGRALQATVLKTWGGKKENVKAAQDALHVRAKANSEATLGTYGGSSTGE--GTESLHVKNYVY 356
168029057 285 KTTKPWALSFSFGRALQATVLKTWGGKKENVKAAQDALHVRAKANSEATLGTYGGNASGE--GTESLHVKNYVY 356
255557204 285 PVLKPWTLSFSFGRALQQSTLKIWAGKKENIEKAQEVFLVRCKSNSEATLGKYTGGGASGL-ASESLYVKGYKY 357
242093550 285 EVLKPWTLSFSFGRALQQSTLKKWLGKKENVAAAQATFLVRCKANSEAGLGKYTGSGAGDAAASESLYVKGYKY 358
302793476 285 DILKPWTLSFSFGRALQQSTLKTWGGKKENVAAAQKVFLVRAKANSDATLGKYSGETESAEGASESLHVKDYKY 358
302774012 285 DILKPWTLSFSFGRALQQSTLKTWGGKKENVEAAQKVFLVRAKANSDATLGKYSGETESAEGASESLHVKDYKY 358
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap