Conserved Protein Domain Family
PLN02452

?
PLN02452: PLN02452 
phosphoserine transaminase
Statistics
?
PSSM-Id: 178071
View PSSM: PLN02452
Aligned: 18 rows
Threshold Bit Score: 562.006
Threshold Setting Gi: 223996875
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255084726   1 MQTPTKWKHNFSAGPSAVDAGVLAKLSAELA-SFEDTGMGLIEHSHRdaGGPVQRCMAATCDLVREVLDVPDSHDVLLMH 79 
159464395  42 FAQPHGRVFNFSAGPAVLPVDVLERAQAELL-NWHGSGMSIMEMSHR--GKEFESVIQKAEADLRTLLNIPSNYKVLFLQ 118
145344328  28 RPGAGNRLYNFSAGPATLPLDVLEEIQRDLV-DYKGSGMSVLEMSHR--GKDYMAIAEKAEKDLRELVGIPDNYKVLFLQ 104
168026402  65 NIEADGRVFNFAAGPATLPAKVVKQAQDELF-NWRGSGMSVMEMSHR--GKEFTAIIQKAEKDFRELLKVPDNYAVLFLQ 141
224084052  29 SQDLEERVFNFAAGPATLPEKVLKKAQSELY-NWHGSGMSVMEMSHR--GKEFLSIIQKAEADLRALLNISEDYAVLFLQ 105
223996875   1 ------KVLNFSPGPTNLPPAVEAAIKQRCFpSPEEKRLGSMALSHR--SPEFGTILRRTLALTRKVMKIPDEYEVLFMQ 72 
255561385  66 SQDLEGRVFNFAAGPATLPANVLKKAQSELY-NWRGSGMSVMEMSHR--GKEFLSIIQKAESDLRSLLEIPDNYSVLFLQ 142
255072473  33 VRASGDRKWNFSAGPAVLPLDVLEDAKEDLI-NYKGTGMSVMEMSHR--GKDFMKIAEEAEADLRELIGIPANYKVLFLQ 109
302838366  41 AAQPHGRVFNFSAGPAILPVDVLERAQADLV-NWQGTGMSIMEMSHR--GKEFESVIQKAEADLRALLNIPSNYKVLFLQ 117
302819089  61 SIENDGRVYNFAAGPATLPANVVKKAQQDLY-NWQGCGMSIMEMSHR--GKEFLSVIQKAEADLRALLAIPDNYEVLFLQ 137
255084726  80 GGAHAMFAGVAMNLGRTMgSKADFVGDGFWSKRAAGEASKYCVvRHVGATSRTLGgvaIPSP-STW--NVDPTAAFVHVT 156
159464395 119 GGASTQFSMIPLNLAKAG-ETVDYVVTGAWSKKAAEEAAKYCK-VNIAAKGDNKS---LPAV-ASW--KLSPDSRYVHYC 190
145344328 105 GGASTMMASNCHNLAAAT-DSADFVVTGAWSVKAQKEGAKMLAkANVIASSKDQSfttIPDV-KDW--KFTEGSKFVHIC 180
168026402 142 GGASTQFSAIPLNLCGPD-DVADYIVTGSWSDKAYKEAKKYCK-SNLVWSGKSEKytrLPSA-SEY--KLTPGAKYVHIC 216
224084052 106 GGATTQFAAIPLNLVKPE-DSVDYVVTGSWGDKAFKEAQKYSK-PKVIWSGKSEKytkIPSF-DSL--ERTPDSKYLHIC 180
223996875  73 GGGHGQFAAVPMNLCSNGsEKATYIINGTWSARAVEEAKKYCDpTVISSVNNDGTytaFPSV-ERIenEMDPNSKFLYLC 151
255561385 143 GGATTQFAAIPLNLCKSD-DSVDFIVTGSWGDKAFKESQKYCK-SKVIWSGKPDKytkIPSN-NDF--EQNPDAKYLHIC 217
255072473 110 GGASSQFSAIPMNLAPEG-GVADFILTGAWGKKAYEEAGKYMT-TNLAASSKDSNfstIPDV-SDW--KLTKDAKFVHIC 184
302838366 118 GGASTQFSMIPLNLAKAG-ETVDYVVTGAWSKKAAEEAKKYCN-VNIAAKGDNKS---LPPV-SGW--KLTPDSRYVHYC 189
302819089 138 GGASTLFSAIPLNLCSPE-DTADFIVTGSWGDKAYKEAQKYCK-ANLAWSGKATKytsIPSSgSEL--KLTPGAKFVHVC 213
255084726 157 ANETIDGLEFHV--DPTMPPdaPPLVGDFTSTLLSRPVD--FSKYSVVYASTGKNLGPSGLVVVIARKDLLTGERemAIT 232
159464395 191 DNETIGGVEFKS--VPDVGD--RVLVSDMSSNFISKPID--VAKYGIIYAGAQKNVGPAGVTIVIIREDLIGHCR--AEA 262
145344328 181 SNETIGGVEFKE--VPDVGN--RVLVADMSSNYLSKPIE--VEKYGIIYGGVQKNIGPAGMGIAIVREDLMGNTR--ADT 252
168026402 217 ANETIQGVEFKD--YPKVDGd-TVLVADVSSNFCSKPID--VSKFGVIYGGVQKNIGPAGVAIAIVRKDLLGKAQ--AQT 289
224084052 181 ANETIHGVEFKD--YPDPKN--GILVADMSSNFCSKPVD--VSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQ--GIT 252
223996875 152 SNETVNGIELHS--LPRFS---VPLVVDASSDFSSKPITwyESNIGILFACASKNIGHPGVTIVVIRKDLLGNAN--PFT 224
255561385 218 ANETIHGVEFKDehYPVAKN--GILVADMSSNFCSKPID--VSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQ--EMT 291
255072473 185 SNETIGGVEFKE--VPDTGD--VPLVADMSSNYLSKPID--VEKYGIIYGGVQKNIGPAGMAIVIVREDLIGKTH--PLC 256
302838366 190 DNETIGGVEFKS--TPDVGD--RVLVSDMSSNFISKPLD--VSKYGLIYAGAQKNVGPAGVTIVIIREDLIGHCR--PEA 261
302819089 214 ANETIHGVEFKDw-YPAVGEg-TILVADMSSNFCSKPVD--VSKFGVIYAGAQKNVGPSGVTIAIVRKDLVGGAQ--PTT 287
255084726 233 PGVMSWSAAAKSApiqNIWNTPNVFGIRALQLVLEDCKAKGGVAAMRARATRRAWSVYDVIDASEGFYVNEV--EPEFRS 310
159464395 263 PTMLDYKIHVEND---SMYNTPPCWAVYVCGLVFEKLVKLGGLDAMQELNRQKAAILYDAIAESQGFYNSPV--DPAVRS 337
145344328 253 PSMFDYKLMADND---SMYNTPPCFTWYVSGLVFAKLLKDGGLKAMEQRNIEKANVLYGAIDGSGGYYVSPV--DTKYRS 327
168026402 290 PVMLDFKTHADND---SLYNTPPCFTIYVCGLVFEDLLAQGGLEAVEKSNIEKAQILYDAIDSSNGFYKCPV--EKSVRS 364
224084052 253 PVMLDYKIHAENN---SLYNTPPCFGIYMCGLVFDDLLAQGGLKEVEKRNKKKGDLLYNTIDESKGFYRCPV--DKSVRS 327
223996875 225 PGIFNYETNVLAE---NVWNTIPTFNVDVIGIVMEWLLENGGMNAMESLSIAKSDLLYDLIDNSNGFYSTPVarESGYRS 301
255561385 292 PVMLDYKIHDDNN---SLYNTPPCYCIYMCGLVFEDLLAQGGLKEVEKKNKKKADLLYNAIDESNGFYRCPV--DKSVRS 366
255072473 257 PTMFDYKLMADND---SMYNTPPCWTMYTSGLVFKKLIKMGGLEAVEKMNEEKAKILYDAIDGSDGYYNNPV--DKKYRS 331
302838366 262 PTMLDYKIHVEND---SMYNTPPCWSIYICGLVFEKLLKLGGLEAMQKLNEEKAAVLYDAIASSNGFYSSPV--DPAVRS 336
302819089 288 PVMLDFKTHADNK---SLYNTPPCFAIYMCGLVFEDLLHQGGLEAIARKNNDKAEILYRAIDGSDGFYKCPV--EASVRS 362
255084726 311 TMTIPVKCKTPE--IEERFVEESEKAGFYNLRGHPLFGG---LRITVYNQVPDDAVEALVGFMQQFQMKVT 376
159464395 338 LMNVPFTIPSSPd-LEKQFIKEAEKAGMLQLKGHRSVGG---MRASIYNAMPIEGVQKLALFMKEFHAKHA 404
145344328 328 LMNVPFTLAGGEe-LEKKFLAEAKAEGFEALKGHRSVGG---ARASIYNAMPKEGVEALVSFMKDFQARNA 394
168026402 365 CMNVPFTMGTPE--LEAAFLKEAAAQGMVQLKGHRSVGG---VRASIYNAMPRAGVEKLVALMKSFQEMNS 430
224084052 328 LMNVPFTLEKSE--LEAEFIKEAAKEKMIQLKGHRSVGG---MRASIYNAMPLAGVEKLVAFMKDFQARHA 393
223996875 302 RMNIPFNIGGGSeeLTDLFLVECWNRGIVGLRTVTPFAKsmfLRASLYHGVAYDEVVVLAQFMKSFAAKHS 372
255561385 367 LMNVPFTLEKSD--LEAEFIKEAAKEKMVQLKGHRSVGG---MRASIYNAMPLAGVEKLVAFMKDFQARHA 432
255072473 332 LMNVPFTLGGGEd-LEKKFLKEAAAAGFESLKGHRSVGG---ARASIYNAMPKEGVQALVDFMADFKAAN- 397
302838366 337 LMNVPFTIPSQPd-LEKVFVKEAEKAGMLQLKGHRSVGG---MRASIYNAMPIEGVQQLATFMKEFAAKHA 403
302819089 363 VMNVPFTMASPE--MEAAFVKEAAGKGMVQLKGHRSVGG---VRASIYNAMPRAGVEKLVALMKDFQARHQ 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap