Conserved Protein Domain Family
PLN02450

?
PLN02450: PLN02450 
1-aminocyclopropane-1-carboxylate synthase
Statistics
?
PSSM-Id: 178069
View PSSM: PLN02450
Aligned: 19 rows
Threshold Bit Score: 920.302
Threshold Setting Gi: 242033111
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242033111  13 PQLLSKKATCNSHGQDSSYFLGWEEYEKNPYDPVANPGGIIQMGLAENQLSFDLLEAWLEDNPDALGLRRGGASVFRELA 92 
18413071    1 --MLSSKVVGDSHGQDSSYFLGWQEYEKNPFHESFNTSGIVQMGLAENQLSFDLIEKWLEEHPEVLGLKKNDESVFRQLA 78 
224067150   1 --MLSAKASHDSHGQDSSYFLGWQEYEKNPYHDVHNPSGIIQMGLAENQLSFDLIESWIARNPDAVGLKKNGASIFKELA 78 
224127212   1 MKLLSRKATCNTHGQDSSYFLGWQEYEKNPYDEIKNPTGIIQMGLAENQLSFDLLESWLANNQDAAGFKKDGQSIFRELA 80 
224097212   1 MRLLSRKATCNTHGQDSSYFLGWQEYEKNPYDEIKNPTGIIQMGLAENQLSFDLLESWLAKNPGAAGFKKDGQSIFRELA 80 
225467508   1 MKMLSRKATFNSHGQDSEYFLGWEEYEKNAYHEVENPSGIIQMGLAENQLSFDLLESWLAQNPDAAGFKRDGESIFRELA 80 
225458928   1 --MLSRKARLDAHGEDSSYFLGWKEYEKNAYDDVQNPTGIIQMGLAENQLSFDLLESWLASNQDAARLTKNGESVFRELA 78 
255537946   2 INMLSTKAGRHSHGQDSSYFSGWQEYEKNPYHQLGNPNGIIQMGLAENQLSFDLIESWLEQNQGIMDLKRNGESIFRELA 81 
255579517   1 MGIEMCNVFVRTVEKAR-----WQEYEKNPYDEIKNPTGIIQMGLAENQLSFDILESWLANNPDAANFKKDGQSIFRELA 75 
297808971   1 --MLSSKVIGDSHGQDSSYFLGWQEYEKNPFHESFNPSGIVQMGLAENQLSFDLIETWLEEHPEVLGLKKNEESVFRQLA 78 
242033111  93 LFQDYHGMPAFKNALARFMSEQRGYRVTFDPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRTGAEI 172
18413071   79 LFQDYHGLPAFKDAMAKFMGKIRENKVKFDTNKMVLTAGSTSANETLMFCLANPGDAFLIPAPYYPGFDRDLKWRTGVEI 158
224067150  79 LFQDYHGLPAFKNALVKFMAEIRGNKVKFDPNKLVLTAGSTSANETLMFCLAERGDAFLVPTPYYPGFDRDLRWRTEVEI 158
224127212  81 LFQDYHGLPAFKKALVEFMAEIRGNKVTFDQNKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEI 160
224097212  81 LFQDYHGLPEFKKALVEFMAEIRGNKVRFDQNKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEI 160
225467508  81 LFQDYHGLPAFKKALVEFMSEIRGNKVSFDQNKLVLTAGATSANETLMFCLANPGEAFLLPTPYYPGFDRDLKWRTGVEI 160
225458928  79 LFQDYHGLPDFKNELVEFMAEIRGNKVNFDPRKLVLMAGATSANETLMFCIAESGDAFLLPTPYYPGFDRDLKWRTGVEL 158
255537946  82 LFQDYHGLPAFKKALAEFMAEIRGNKVKFDPEKLVLTAGSTSANETLMFCLAERGDAFLLPTPYYPGFDRDLKWRTGVEI 161
255579517  76 LFQDYHGLPDFKKAMVEFMSEIRGNRVTFDQNKLVLTAGATSANETLIFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEI 155
297808971  79 LFQDYHGLPAFKDAMAKFMGKIRENKVKFDTNKMVLTAGSTSANETLMFCLANPGDAFLIPAPYYPGFDRDLKWRTGVEI 158
242033111 173 VPVHCTSANGFRVTRAALDDAYRRAQKQRLRVKGVLITNPSNPLGTTSPRADLEMLVDFVAAKGIHLVSDEIYSGTAFAE 252
18413071  159 VPIHCVSSNGYKITEDALEDAYERALKHNLNVKGVLITNPSNPLGTSTTREELDLLLTFTSTKKIHMVSDEIYSGTVFDS 238
224067150 159 VPIHCSSSNDFQITMPALEKSYQEAQRLDLKVKGVLITNPSNPLGTTMTRDELNHLISFCTAKNIHIVSDEIYSGTVFDC 238
224127212 161 VPIQCTSSNGFQITAPALEDAFQEAQKRNLRVKGVLVTNPSNPLGTTITRSELNLLLSLITEKGIHLISDEIYSGTVFNS 240
224097212 161 VPIQCTSSNGFQITAPALEEAFQEAQKRNLRVKGVLVTNPSNPLGTTMTGNELNLLLSFVTEKGIHLISDEIYSGTVFSS 240
225467508 161 VPIQCSSSNGFQITESALEEAYQQAQKRSLKVKGVLITNPSNPLGTTTSRDELNLLVNFITAKGIHLISDEIYSGTVFDS 240
225458928 159 VPIHCSSSNGFKVTKCALEEAYQQAHKLSLNVKGVLITNPSNPLGTTMGRDELNDLIDFAVAKKIHIISDEIYSGTVFDH 238
255537946 162 VPIHCS------------KKAYQQALRLGLKPKGILITNPSNPLGTSMTRNELNHLITFAMAKQVHLVSDEIYSGTVFDY 229
255579517 156 VPIHCTSSNGFQVTASALEEAYLEAQNRNLKVKGVLVTNPSNPLGTAMTRTELNLLVNFISDKSIHLICDEIYSGTVFSS 235
297808971 159 VPIHCVSSNGYKITEDALEDAYERARELNLNVKGVLITNPSNPLGTSTTREELDLLLTFTSTKKIHMVSDEIYSGTVFDS 238
242033111 253 PGFVSVLEVVAARRRNSTDadglLSERVHVVYSLSKDLGLPGFRVGAIYSSNAGVVSAATKMSSFGLVSSQTQHLLASLL 332
18413071  239 PEFTSVLEVAKDKNMG-------LDGKIHVVYSLSKDLGLPGFRVGLIYSNNEKVVSAATKMSSFGLISSQTQHLLANLL 311
224067150 239 PKFISITEALMDRHLENTD----IWSRIHVVYSLSKDLGLPGFRVGMIYSNNETLVSAATKMSSFGLISSQTQYLLSGML 314
224127212 241 PGFVSVMEVLKDMKCESSQ----VWNRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVSAATKMSSFGLVSSQTQYLLAALL 316
224097212 241 PGFVSILEVLKDRKCENSQ----VWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVSAATKMSSFGLVSSQTQYLLSALL 316
225467508 241 PGFVSIMEVLMDRNYMNTE----VWKRVHIVYSLSKDLGLPGFRVGAIYSNDVAVVSAATKMSSFGLVSSQTQYLLSVML 316
225458928 239 PSFISIMEALMDRKLQDTD----LWSRVHIVYSLSKDLGLPGFRVGMIYSNNETVVSAATKMSSFGLISSQTQYLLSKIL 314
255537946 230 PNFIGITEALMDRQLENTD----IWNRVHIVYSLSKDLGLPGFRVGMIYSNNETVVAAATRMSSFGLVSSQTQYLLSNML 305
255579517 236 PGFVSIMEVLKDRKCENTE----ISNRVHIVYSLSKDLGLPGFRVGAIYSNDDLVVSAATKMSSFGLVSAQTQHLLSALL 311
297808971 239 PEFTSVLEVAKDKNMD-------LDEKIHVVYSLSKDLGLPGFRVGLIYSNNEKVVSAATKMSSFGLISSQTQHLLANLL 311
242033111 333 GDRDFTRRYIAENTRRIKARRDQLAEGLAAIgGVECLESNAGLFCWVNMRGLMRTPSFEGEMELWKKVVFEVGLNISPGS 412
18413071  312 SDERFTTNYLEENKKRLRERKDRLVSGLKEA-GISCLKSNAGLFCWVDLRHLLKSNTFEAEHSLWTKIVCEVGLNISPGS 390
224067150 315 SESKFTNNYMEKNSKRLRKRKEMLVSGLQSA-GIKCLKSNAGLFCWVDMRHLLSSQTFEAEKELWKKILFDVGLNIPPGS 393
224127212 317 SDKKFTRNYISENQKRLKQRQKLLVKGLEKA-GISCLKSNAGLFCWVNMKHLLSSNTFDAEMELWKKIVHQVKLNISPGS 395
224097212 317 SDKKFTRNYISENQKRLKQRQKLLVKGLEKA-GISCLKSNAGLFCWVNMKHLLSSNTFTEEMELWKKIVHEVKLNISPGS 395
225467508 317 SDKKFTKNYVSENQKRLKQRHQMLISGLQNA-GIDCLKSNAGLFCWVDMRHLLSSNTFEAEMELWKKILYDVRLNISPGS 395
225458928 315 SDKKFTRNYLKENRKRLKTRREMIVAALRNA-GIGCLKSNAGLFCWVDMRHLLSSNTFDAEMELWKRILREAGLNISPGA 393
255537946 306 ADKKFTSTYIEENQKRLRKRKEKLIAGLENA-GIKCLKSNAALFCWVDMRRLLKTQTFEAEKEIWKKILGQVGLNISPGS 384
255579517 312 SDKKFTKHYISENQKRLKQRQKMLIKGLEKA-GISCLKSNAGLFCWVNMKHLLKSNTFEAEMELWKTIVYDVKLNISPGS 390
297808971 312 SDERFTTNYLEENKKRLRERKDRLVSGLKEA-GIGCLKSNAGLFCWVDLRHLLKSNTFEAEHSLWTKIVCEVGLNISPGS 390
242033111 413 SCHCREPGWFRVCFANMSAKTLDVALNRLAAFAEAaavegrGRGPAAAAAARRVLGPARSMslpIRFSWANRLTPASaad 492
18413071  391 SCHCDEPGWFRVCFANMSDQTMEVAMDRVKGFVDN---------NNGGKQKRTMWDTRRRS---LINKWVSKLSSVT--- 455
224067150 394 SCHCSEPGWFRICFANLSEGTLKVAMKRIKNFVDN---------------NYQEMQTLFNS---TDQNLLYKIK------ 449
224127212 396 SCHCTEPGWFRVCFANMSEETLNLAIQRLKSFVES--------MNINNQSHHQLLKNARRK---SLAKWVLRLSFDHd-- 462
224097212 396 SCHCTEPGWFRVCFANMSEETLNLAIQRLKSFVES----------MKNQSHHQMLKSSRRK---FLTKWVFRLSFDHd-h 461
225467508 396 SCHCTEPGWFRVCFANMSEDTLNLALQRIKAFVDS------STTTNNNQSRHQSNKNQRRK---SFTKWVFRLSFRD--- 463
225458928 394 SCHCSEPGWFRICFANMSEDTLNLSMQRIKALAERi-----QQCRRGRVTHQDSGCNSRRR---SFSKWVLNLCSYD--- 462
255537946 385 SCHCSEPGWFRMCFANMSEETLTVAMERIKSFVESiiaittTSSNRQRKTNYHQMISDQRV---HINKWVSKLSSHD--- 458
255579517 391 SCHCTEPGWFRICFANMSEDTLNLAMNRLKSFVDS-------INNTQNQSSHQMLKNSRRR---SLTKWVFRLSFDNgre 460
297808971 391 SCHCDEPGWFRVCFANMSDQTMEVAMDRVKGFVEN---------NTRGKQKRTMWDTRRRS---LINKWVSKLSSVT--- 455
242033111 493 RKAER 497
18413071  456 CESER 460
224067150     -----    
224127212 463 REPEE 467
224097212 462 REPDE 466
225467508 464 REASE 468
225458928 463 REPDR 467
255537946 459 LVPLR 463
255579517 461 REPEE 465
297808971 456 CESER 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap