Conserved Protein Domain Family
PLN02449

?
PLN02449: PLN02449 
ferrochelatase
Statistics
?
PSSM-Id: 178068
View PSSM: PLN02449
Aligned: 31 rows
Threshold Bit Score: 487.422
Threshold Setting Gi: 255596451
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223994621  15 TALPFGLGVSAFSSSISPRVASPSSLSRPPQHVHASAPPSSTSSYRSATTTKLAAATALDLSDESITLPSWDKNDDTSTD 94 
159468456   5 GLMQRTVHCPQLVEERCSPVAGCSGRGLPVIQRQR------RGVCSATNGVQRGRVLRRTAASTDVVSFVDPNDIRKPAA 78 
145352028     --------------------------------------------------------------------------------    
219117493   1 ---MHKHRHIAHSIDSMRLLHRQRSVSGSLLCVLLVFLSAVSKCQCFSTHSSSRRDSLQLPLQSTMPLKVAAAPILEASP 77 
225429458   2 EAVSTSSILPHGKVSGLNHRSFNQKSSMSCPQTRSFKSAHCYSSEGLKGSQLLNSIEKRNPVGQTFSSAGAYTYVGSAVE 81 
242044236  16 ILGMETGAATSCGKTTSISFTGSTKHEQNLHENVKPSQFATNGSSRLVYRSSVLKNQWNLSASSSSANVVTTFDDDKDVS 95 
224092212   1 -----------------------------------------------------MKRNPVRQAFCAASVVGVGAYCEGFVD 27 
255086613  14 VVGTSTRRVAATRVAGSGARAGGARRAAKS-----------SSSESKGSRGSSLVGTNPGRRLRVAARAVSDPSMTGWDA 82 
255550838  16 SLLQSRSITSVSCNSSGKSQYHAKQSSLAFSFSSSSSIEKSVAIDGASNLLSPAQKRDSVGQIFCTASTGGWPISEGFVE 95 
302840509   1 -MASFGLHQRMASAPHIEERAGCSSRCSPAIQGCWRTRVHGARGVATASERRRVVSLRRSAASTDVVCFDDSHDVKGRQA 79 
223994621  95 TIAKLKDPKVGVLLLNLGGPETGEDVEGFLYNLFADPDIIRLPSILSPLQSLVALLISKRRAPKSREAYDSIGGGSPILQ 174
159468456  79 AAAGPAVDKVGVLLLNLGGPEKLDDVKPFLYNLFADPEIIRLPAAAQFLQPLLATIISTLRAPKSAEGYEAIGGGSPLRR 158
145352028   1 --------KVGVLLLNLGGPETLDDVQPFLYNLFADPDIIRLPPPVQFLQGFLANTLSASRAPKSREAYESIGGGSPLRR 72 
219117493  78 LVIEPTNPKVGVLLLNLGGPETGDDVEGFLYNLFADPDIIRLPGPLAPLQNLIALFISKRRAPKSRAAYESIGGGSPILK 157
225429458  82 SPTHAVEEKVGVLLLNLGGPETLHDVQPFLFNLFADPDIIRLPRLFQFLQRPLAQLISVIRAPKSKEGYAAIGGGSPLRK 161
242044236  96 SSVV--EEKIGVLLLNLGGPETLDDVQPFLFNLFADPDIIRLPRLFRFLQRPLAKLISTFRAPKSKEGYASIGGGSPLRK 173
224092212  28 SHLHVTEEKVGVLLLNLGGPETLNDVQPFLFNLFADPDIIRLPRLFQFLQKPLAKLISVLRAPKSKEGYASIGGGSPLRK 107
255086613  83 GRIDEKEDVVGVLLLNLGGPETLDDVQPFLYNLFADPDIIRLPGALQFLQSPLAALLSNSRAPKSREAYESIGGGSPLRR 162
255550838  96 SHLHATEEKVGVLLLNLGGPETLNDVQPFLFNLFADPDIIRLPRLFQFLQRPLAQLISMLRAPKSKEGYAAIGGGSPLRK 175
302840509  80 AAAPPAVDKVGVLLLNLGGPETLNDVKPFLFNLFADPEIIRLPQVVQFLQPFLATIISTLRAPKSAEGYKAIGGGSPLRR 159
223994621 175 YTRAQADLMAESLKSRYGiEAKTYIGMRYWYPFTEEALAQIREDGINALVILPLYPQFSISTSGSSLRVLQEEFARnsDF 254
159468456 159 ITDEQAEALAESLRAKGQ-PANVYVGMRYWHPYTEEALEHIKADGVTRLVILPLYPQFSISTSGSSLRLLESLFKS--DI 235
145352028  73 ITEDQANALQAAMQARGI-QAKTYVGMRYWKPFTEDAIDAIKRDGVTRLVVLPLYPQFSISTSGSSLRLLEQYFAE--DE 149
219117493 158 YSNAQADLLCQSLQRRYGmDVKAYIGMRYWHPFTEEALDQIQNDRIEALVILPLYPQFSISTSGSSLRVLQEEFSKhsEK 237
225429458 162 ITDEQAHAIKAALEAKNM-HVNVYVGMRYWYPFTEEAIEQIKKDKITRLVVLPLYPQFSISTTGSSIRVLESIFRE--DA 238
242044236 174 ITDEQANALKAALKKKNL-NANIYVGMRYWYPFTEEAIDQIKKDKISKLVVLPLYPQYSISTSGSSIRVLQNIVKE--DS 250
224092212 108 ITDEQADGIKMALKAKGL-TANVYVGMRYWYPFTEEAIHQIKKDKITKLVVLPLYPQFSISTTGSSLRVLQNIFSE--DA 184
255086613 163 ITDEQANALQSALVAKGLkNAKCYVGMRYWKPFTEEAVEQIKADGVTKLVVLPLYPQFSISTSGSSLRLLEQIFGE--DE 240
255550838 176 ITDEQAHAIKMALEAKGM-SANVYVGMRYWYPFTEEAIHQIKKDRITKLVVLPLYPQFSISTTGSSLRVLENMFRE--DG 252
302840509 160 ITDDQANALADALKAKGQ-AANVYVGMRYWHPYTEEALEHIKRDGVTRLVILPLYPQFSISTSGSSLRLLESLFKS--DR 236
223994621 255 YGpQRMFHTVVPSWYDRPGYVKSVANLINKEL----ESFtpeeia-egtsdGQPIPKHVLFSAHGVPASYI-EAGDPYKD 328
159468456 236 AL-KSLRHTVIPSWYQRRGYVSAMADLIVEEL----KKF------------RDVPSVELFFSAHGVPKSYVeEAGDPYKE 298
145352028 150 EL-ASVRHTVIPSWYQRPGYVKAMAVMIAQTLk---TKF------------EDDKEPLIFFSAHGVPVSYVeQAGDPYKD 213
219117493 238 Y--SKMMHTVVPSWYDRPGYVKAMADLLKKEL----DSFtdaqiaeakqtsPDQKPLHVLFSAHGVPQSYI-EAGDPYQR 310
225429458 239 YL-SRLPVSIIQCWYQRQGYINSMADLIEEEL----QIF------------SKPKEVMIFFSAHGVPVSYVeDAGDPYRD 301
242044236 251 YF-SGLPISIIESWYQRDGYVKSMADLIEKEL----SAF------------SNPEEVMIFFSAHGVPLTYVeDAGDPYRD 313
224092212 185 YL-SRLPIAIIQSWYQREGYIKSMADLIGEEL----QKF------------AKPEEVMIFFSAHGVPLTYVeDAGDPYKD 247
255086613 241 YLaTRMSHTVIPSWYERPGYVQAMADLIKAELnrpdSQF------------DSPDEPIVFFSAHGVPVSYVeTAGDPYKE 308
255550838 253 YL-SRLPVCIIQSWYQREGYVKSMADLIGTEL----KKF------------SNPKEVMIFFSAHGVPLSYVeEAGDPYKD 315
302840509 237 AL-KQLRHTVIPSWYQRRGYVCAMADLIVQEL----GKF------------QDVPSVELFFSAHGVPKSYVeEAGDPYKE 299
223994621 329 QIIDCVERISALLPSEEDGVKVHLSFQSRVGPVEWLRPYTDDVLPSLGEQGVKNLVVVPISFVSEHIETLEEIDIEYREL 408
159468456 299 EMEECVRLITDEVKRRGFANTHTLAYQSRVGPAEWLKPYTDESIKELGKRGVKSLLAVPISFVSEHIETLEEIDMEYREL 378
145352028 214 EMEACVRLITEELGSMGVNNEHVLAYQSRVGPVEWLKPYTDDTIRELGKKGTEALCAVPISFVSEHIETLEEIDMEYREL 293
219117493 311 QIQECVAKISAELPYEN--VQVHLSYQSRVGPIEWLRPYTDDVLPELGASGVRNLVVVPISFVSEHIETLEEIDIEYREL 388
225429458 302 QMEECIYLIMQELKARGISNKHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAVPVSFVSEHIETLEEIDMEYKHL 381
242044236 314 QMEDCISLIMGELRSRGILNGHTLAYQSRVGPVQWLKPYTDEVLVELGKNGVKSLLAVPVSFVSEHIETLEEIDMEYKEL 393
224092212 248 QMEECIYLIMQELKARGSYNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAVPVSFVSEHIETLEEIDMEYKEL 327
255086613 309 EMEECVALIMARLKEMGVANEHVLAYQSRVGPVEWLKPYTDDVIRELGEKKTKAMVAVPISFVSEHIETLEEIDMEYREL 388
255550838 316 QMEECIYLIMQELKARGFDNDHTLAYQSRVGPVQWLKPYTDEVLVELGRKGVKSLLAVPVSFVSEHIETLEEIDMEYKEL 395
302840509 300 EMEECVRLIMEEVRARGFNNSHTLAYQSRVGPAEWLKPYTDESIRELGRRGVKSLLAVPISFVSEHIETLEEIDMEYREL 379
223994621 409 ALESGITNWRRSPALNTDATFIEDMADMVADALn-----ePSQ---------------SVTEAC-----VANNVGNLELE 463
159468456 379 AEESGIRNWGRVPALNTNAAFIDDLADAVMEAL-------PYV---------------GCLA--------GPTDSLVPLG 428
145352028 294 AEESGIKKWGRVPALDTDPLFIDDLADAVIEAL-------PYT---------------TRMSKTr----ASASGLNVPPA 347
219117493 389 AEESGISNWRRCPALNTDATFIDDMADLVVDALa-----ePAQ---------------SVTEAC-----VANMVGDVELQ 443
225429458 382 ALESGIENWGRVPALGCTSSFITDLADAVIEAL-------PAA---------------KAMTTQs----TSKEFNMDPVN 435
242044236 394 ALESGIENWGRVPALGCTSTFISDLADAVVEAL-------PSA---------------SALATRk---pEDTDSNMDLMH 448
224092212 328 ALESGIENWGRVPALGCTSSFITDLADAVIEAL-------PSA---------------KSFSTTr---sTSEESDRDFLS 382
255086613 389 AEESGVEQWGRVPALDTNPVFIDDLADAVVESLdgmskaaSMSegdlaaavatssvlrGSLDESspttkRKVRGDLAATP 468
255550838 396 ALESGIENWGRVPALGCTSSFITDLADAVIEAL-------PSA---------------KAISTSk---sTSEEADYDPFR 450
302840509 380 AEGSGIRNWGRVPALNTNAAFIDDLADAVLEAL-------PYV---------------GCLA--------GPTDSLVPLG 429
223994621 464 AVSNRMEISSAGVLGVGnVDDL----------AGKAKLRkgelingrLAMMGIFVTILLEFASGKPLIHF 523
159468456 429 DLEMLLQAYDRERRTLPsPVVM----------WEWGWTKsaetwngrIAMIAIIIILALEAASGQSILKN 488
145352028 348 EVGELLASYDRAKLAIPvP--------------------------------------------------- 366
219117493 444 PLDERLGINTGGVQGVG-AEGL----------LYQAKLQekervnarVAMMGVLITLMVELATGKPFTQM 502
225429458 436 YAIKMFF----------------------------------------GSILAFVLLLSPKMISKFKNQLF 465
242044236 449 YLTKMFF----------------------------------------GSILAFMLLLSPRLVSAFRNTML 478
224092212 383 YAIKMIF----------------------------------------GSVLAFVLLFSPKVITAFRNLLF 412
255086613 469 PVPMMPTGTGSRVRNVPsTDDVtdllgvkpepWEWGPVE--------FSMVALSILLSTMLLMDSSGGAG 530
255550838 451 YAIKLFF----------------------------------------GSILAFILLLSPKMIFAFRNNVL 480
302840509 430 DLEMLLQAYDRERRALPsPVVM----------WEWGWTKsaetwngrIAMLAIIVILVLEATSGQSILKN 489
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap