Conserved Protein Domain Family
PLN02443

?
PLN02443: PLN02443 
acyl-coenzyme A oxidase
Statistics
?
PSSM-Id: 178062
View PSSM: PLN02443
Aligned: 12 rows
Threshold Bit Score: 1311.75
Threshold Setting Gi: 302759741
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302785646   4 AGRIDHLSGERQKAQFDLQPMRVLLAGGEHELDVAQRVAAIVARDPVFSKANRTRLSREELYKNSLRKASHGWKLIQQLK 83 
15227469    1 MERVDHLADERNKAEFNVDDMKIVWAGSRHAFDVSNRMSRLVANDPVFEKSKRAVMSRKELFKNTLRKSVHAWKLINELR 80 
115465886   6 GGEVDHLAGERATAQFDVEHMKVAWAGSRHAVDVADRMARLVASDPVFRKDNRTMLPRKELFKDTLRKAAHAWKRIVELR 85 
168048513   4 GNGLDHLAGERAMAQFDLQAMKVYLAGGQREYEISTKMAQLVANDPVFSKEDRVRLARKDLYKNSLRKAGHAWKTILEKG 83 
240255949   1 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLSRKELFKSTLRKCAHAFKRIIELR 80 
224071137   1 MEGVDILPHERSKKQFDVDAMKIVWAGSRQAFEVSDRMARLVASDPAFQKDNRSRLGRKELFKNTLRKATYAWKRIIELR 80 
224138652   1 MKGVDHLAHERNKTEFDVDAMKIVWAGSRHAFELSDRMARLVASDPAFQKDGRTRLGRKELFKNTLRKAAHAWKRILELR 80 
242092078   4 AAEVDHHAAERAAVRFDVEAMKVAWAGSRHAVEVGDRMARLVASDPVFRKDNRTMLSRKDLFKDTLRKAAHAWKRIVELR 83 
255568739   1 MEGVDHLAEERNKAQFDVDEMKIVWAGSRHAFDVADRMARLVASDPAFRKDNRAMLSRKELFKNTLRKAAHAWKRIIELR 80 
297823369   1 MERVDHLADERNKAEFNVDDMKIVWAGSRHAFDVSNRISRLVANDPIFEKSKRAVMRRKELFKNTLRKSVHAWKMINELR 80 
297800438   1 MEGVDHLADERNKAEFDVEEMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLSRKELFKSTLRKCAHAFKRIIELR 80 
302759741   4 AGRIDHLSGERQKAQFDLQPMKVLLAGGEHELDVAQRVAAIVARDPVFSKANRTRLSREELYKNSLRKASHGWKLIQQLK 83 
302785646  84 LTEEEAFKLRSLVDEPTFTDLHWGMFVPAIKGQATDEQQKYWLPLAYKMAVIGCYAQTELGHGSNVQGLETTATFDPATD 163
15227469   81 LSDEEGLKLRSFMDQPGFLDLHWGMFVPAIKGQGTEQQQQKWLSLATKMQIIGCYAQTELGHGSNVQGLETTATFDPKTD 160
115465886  86 LTEEEANLLRLYVDQPGYVDLHWGMFVPAIKGQGTEEQQKKWLPLAYRFQIIGCYAQTELGHGSNVQGLETTATFDPKTD 165
168048513  84 LSEVEGLKLRHFVDEPTYTDLHWGMFIPAIKGQGTEEQQHKWLPLAYKMAIIGCYAQTELGHGSNVQGLETTATFDPTTD 163
240255949  81 LNEEEAGRLRHFIDQPAYVDLHWGMFVPAIKGQGTEEQQKKWLSLANKMQIIGCYAQTELGHGSNVQGLETTATFDPKTD 160
224071137  81 LTEEEAGRLRFFVDEPAFTDLHWGMFVPAIKGQGTEEQQQKWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPDKD 160
224138652  81 LTEEEAGWLRSFVDEPSFTDLHWGMFIPAIKGQGTDEQQQKWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPETD 160
242092078  84 LTEEEAGMLRLYVDQPGYVDLHWGMFVPAIKGQGTEEQQKKWLPMAYKFQIIGCYAQTELGHGSNVQGLETTATFDPKTD 163
255568739  81 LSEEEASKLRTFVDEPAYTDLHWGMFVPAIKGQGTEEQQKKWLPLAHKMQIIGCYAQTELGHGSNVQGLETTATFDLETD 160
297823369  81 LSDEEGIKLRSFMDQPGFLDLHWGMFVPALKGQGTEEQQHKWLSLANKMQIIGCYAQTELGHGSNVQGLETTATFDPKTD 160
297800438  81 LNEEEAGRLRHFIDQPAYVDLHWGMFVPAIKGQGTEEQQKKWLSLASKMQIIGCYAQTELGHGSNVQGLETTATFDPKTD 160
302759741  84 LTEEEAFKLRSLVDEPTFTDLHWGMFVPAIKGQATDEQQKYWLPLAYKMAVIGCYAQTELGHGSNVQGLETTATFDPATD 163
302785646 164 EFVMNSPNLTSTKWWPGGLGKASTHALVYARLITDNHDYGIHAFIVQIRSLDDHKPLPGVTVADIGVKFGNAGYNTMDNG 243
15227469  161 QFIIHSPTQTSSKWWPGGLGKVSTHAVIYARLITNGKDHGVHGFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNG 240
115465886 166 EFVIHSPTLTSSKWWPGGLGKASTHAVVYARLITEGKDYGIHGFIVQLRSLEDHSPLPGVTLGDIGGKFGSGAYNSMDNG 245
168048513 164 EFIMHSPTVTSTKWWPGGLGKASTHALVYARLITDKKDHGIHAFIAPIRSLEDHTPLPNVTVGDIGVKFGNGGYNTMDNG 243
240255949 161 EFVIHTPTQTASKWWPGGLGKVSTHAVVYARLITNGKDYGIHGFIVQLRSLEDHSPLPNITVGDIGTKMGNGAYNSMDNG 240
224071137 161 EFVIHSPTLTSSKWWPGGLGKVSTHAVVYARLITNGEEHGVHGFIVQLRSLDDHMPLPGITIGDIGMKFGNGAYNT---- 236
224138652 161 EFVIHSPTLTSSKWWPGGLGKVSTHAIVYARLITNGQEHGVHGFIVQLRSLDDHMPLPGLTIGDIGMKFGNGAYNTMDNG 240
242092078 164 EFVIHSPTLTSSKWWPGGLGKASTHAVVYARLITEGKDYGIHGFIVQLRSLEDHSPLPGVTLGDIGGKFGSGAYNSMDNG 243
255568739 161 EFVIHSPTLTSSKWWPGGLGKVSTHAVVYARLITEGREHGVHGFIVQLRSLDDHMPLPGITVGDIGMKFGSGAYNTMDNG 240
297823369 161 QFIIHSPTQTSSKWWPGGLGKVSTHAVVYARLITNGKDHGVHGFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNG 240
297800438 161 EFVIHTPTQTASKWWPGGLGKVSTHAVVYARLITNGKDYGIHGFIVQLRSLEDHSPLPNITVGDIGTKMGNGAYNSMDNG 240
302759741 164 EFVMNSPNLTSTKWWPGGLGKASTHALVYARLITDNHDYGIHAFIVQIRSLDDHKPLPGVTVADIGVKFGNAGYNTMDNG 243
302785646 244 LLRFDQVRIPRNNMLMKLAKVTKEGKYISSDVPKQLAYGAMVYVRQSIVSDASVYLSRAVTIAVRYSCVRRQFGGQGNDP 323
15227469  241 FLMFDHFRIPRDQMLMRLSKVTREGKYVASDVPRQLVYGTMVYVRQSIVSNASTALARAVCIATRYSAVRRQFGSHDGGI 320
115465886 246 VLRFDHVRIPRDQMLMRLSQVTKEGKYVHSDVPKQLLYGTMVFVRQTIVADASKALSRATCIAVRYSAIRKQFGPQTGGP 325
168048513 244 FLRFDHVRIPRENMLMRLATVTKDGKYVRSNKPRQLGYGAMVFVRQGIVIDASIYLSRAVTIAVRYSAVRRQFGNKDEPG 323
240255949 241 FLMFDHVRIPRDQMLMRLSKVTREGEYVPSDVPKQLVYGTMVYVRQTIVADASNALSRAVCIATRYSAVRRQFGAHNGGI 320
224071137 237 --------------------VTREGKCVQSNVPRQLIYGTMVFVRQTIVADASSALSRAVCIATRYSAVRRQFGSQDG-V 295
224138652 241 VLKFDHIRIPRNQMLMRVLQVTREGKCVQSNVPRQLIYGTMVFVRQTIVADASTALSRAVCIATRYSAVRRQFGSQDGGM 320
242092078 244 VLRFDHVRIPRDQMLMRLSQVTREGKYVNSDVPKQLLYGTMVFVRQTIVADASKALSRAVCIAVRYSAIRKQFGSQDGGP 323
255568739 241 VLRFDHVRIPRNQMLMRVMQVTREGKCVQSKVPRQLIYGTMVYVRQTIVADASAALSRAVCIATRYSAVRRQFGSNDGGV 320
297823369 241 FLMFDHFRIPRDQMLMRLSKVTREGKYVASDVPRQLVYGTMVYVRQSIVSNASTALARAVCIATRYSAVRRQFGSQDGGI 320
297800438 241 FLMFDHVRIPRDQMLMRLSKVTREGKYVPSDVPKQLVYGTMVYVRQAIVADASIALSRAVCIATRYSAVRRQFGAHNGGI 320
302759741 244 LLRFDQVRIPRNNMLMKLAKVTKEGKYISSDVPKQLAYGAMVYVRQSIVSDASVYLSRAVTIAVRYSCVRRQFGGQGNDP 323
302785646 324 ETQVIDYKTQQHRLFPLLATTYAYRIVGQWLKWLYSDVMNRLESYDFSTLPEVHACTSGLKSLTTSVAADGIEECRKLCG 403
15227469  321 ETQVINYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTKRLEASDFATLPEAHACTAGLKSMTTSATSDGIEECRKLCG 400
115465886 326 ETQVLNYKTQQSRLFPLLASAYAFRFVGEWLKWLYTDVTHKLEAKDFSTLQEAHACTAGLKAVTTSATADGIEECRKLCG 405
168048513 324 ELQVIQYRTQQSRLFPLLATAYAYRAVGFWMKSLYADVMKRLNDNDFSTLPEVHACTAGLKSITTSVTADGIEECRKLCG 403
240255949 321 ETQVIDYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTERLAASDFATLPEAHACTAGLKSLTTTATADGIEECRKLCG 400
224071137 296 ETQVIDYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTQRLQANDFSTLPEAHACTAGLKSLTTTATADAIEECRKLCG 375
224138652 321 ETQVIDYKTQQSRLFPLLASAYAFRFVGEWLKWLYTDVTQRLQANDFSTLPEAHACTAGLKSLTTTATADAIEECRKLCG 400
242092078 324 ETKVLDYKTQQSRLFPLLASAYAFRFVGDWLKWLYMDVTQKLEAKDYSTLQETHACTAGLKAVTTSATADAIEECRKLCG 403
255568739 321 ETQVIDYKTQQSRLFPLLASAYAFRFVGEWLKWLYTDVTQRLQANDFSTLPEAHACTAGLKSLTTSFTADAIEECRKLCG 400
297823369 321 ETQVIDYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTKRLDTSDFATLPEAHACTAGLKSMTTSATSDGIEECRKLCG 400
297800438 321 ETQVIDYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTERLAASDFATLPEAHACTAGLKSLTTTATADAIEECRKLCG 400
302759741 324 ETQVIDYKTQQHRLFPLLATTYAYRIVGQWLKWLYSDVMNRLESHDFSTLPEVHACTSGLKSLTTSVAADGIEECRKLCG 403
302785646 404 GHGYLCSSGLPELYAAYVPACTYEGDNVVLLLQVARFLLKTLSQLGGGVKPVGTASYLGNLPVLTKQGSRVSQGTDWLDH 483
15227469  401 GHGYLWCSGLPELFAVYVPACTYEGDNVVLQLQVARFLMKTVSQLGSGKAPSGTTAYMGRAKHLLQCSSGVRNARDWLNP 480
115465886 406 GHGYLNSSGLPELFAIYVPACTYEGDNVVLLLQVARFLMKTVSQLASGKQPVGTTAYMGNIQYLMQCKCGVNTAEDWLNP 485
168048513 404 GHGFLCASGLPELYAAYVPACTYEGDNTILLLQVARFLLKTLSQV-SKVRPVGTAAYLGNIKQLSTQNCKVSQGHDWLNT 482
240255949 401 GHGYLWCSGLPELFAVYVPACTYEGDNVVLQLQVARFLMKTVAQLGSGKVPVGTTAYMGRAAHLLQCRSGVQKAEDWLNP 480
224071137 376 GHGYLCASGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSQLGSGKEPIGTTAYLGRVQDLMQCCCEVQTAEDWLKP 455
224138652 401 GHGYLCASGLPELFAVYVPACTYEGDNVVLLLQVARFLMKTVSQLGSGKKPVGTTAYLGRVQDLLQCCCDVQTAEDWLKP 480
242092078 404 GHGYLNSSGLPELFAVYVPACTYEGDNIVLLLQVARILMKTVSQLASGKQPVGTMAYMGNVQYLMQCKCAVNTAEDWLNP 483
255568739 401 GHGYLTASGLPELFAVYVPACTYEGDNVVLLLQVARFLMKTVSQLGSGKKPVGTTAYMARVEHLLQCRCGAQKAEDWLKP 480
297823369 401 GHGYLWCSGLPELFAVYVPACTYEGDNVVLQLQVARFLMKTVSQLGSGKAPSGTTAYMGRAKHLLQCRSSVRNAEDWLNP 480
297800438 401 GHGYLWCSGLPELFAVYVPACTYEGDNVVLQLQVARFLMKTVAQLGSGKVPVGTTAYMGRAAHLLQCRSGVQKAEDWLNP 480
302759741 404 GHGYLCSSGLPELYAAYVPACTYEGDNVVLLLQVARFLLKTLSQLGGGVKPVGTASYLGNLPVLTKQGSRVSQGTDWLDH 483
302785646 484 SNLLYAFEARAARLAL-VAAQLVQKAGNEAGFEQHSIELIEAARAHCELMVLSKFVERLQRGVPGRGVQRQLDILCEVYG 562
15227469  481 GMVLEAFEARALRMAVtCANNLSKFENQEQGFSELLADLVEAATAHCQLIVVSKFIAKVEGDIEGKGVKKQLKNLCYIYA 560
115465886 486 AAIREVFEARALRMAVnCAQNINKAPSQEEGFYELSPDLLEVAVAHIQLIIVTKFIEKLEQDIPGEGVKEQLCILCNVYA 565
168048513 483 SVLLEAFEARSARQAAaVALRLAKGSGSEAEFQENTPELVESARAHCQLILVSKFIEQLQTGTP-EGIRKQLEVLCYTYA 561
240255949 481 DVVLEAFEARALRMAVtCAKNLSKFENQEQGFQELLADLVEAAIAHCQLIVVSKFIAKLEQDIGGKGVKKQLNNLCYIYA 560
224071137 456 SVMLEAFEARSARMCVaRAQNLSKFANPEDGFAELSADLVEAAVAHCQLIVVSKFFDKLQQDIPGNGVKQQLQNLCYIYA 535
224138652 481 SVVLEAFEARSARMCVaRAQNLSKFENPEDGFAELSADLVEAAVAHCQLIVVSKFIDKLQQDIPGKGVNQQLQNLCYIYA 560
242092078 484 VAIQEAFEARALRMAVnCAQNIGQAASQEEGFSERSPDLLEAAVAHIQLIIVTKFIAKVQQDIPGHGVKEQLQNLCNVYA 563
255568739 481 NVILEAFEARAARMCVtRAQSLSHYPNPEEGFAELSADLVEAAVAHCQLIVVSKFIEKLQQEIPGKGVKQQLQILCYMYA 560
297823369 481 GMVLEAFEARALRMAVtCANNLSKFENQEQGFSELLADLVEAATAHCQLIVVSKFIAKVEGNIEGKGVKKQLKNLCYIYA 560
297800438 481 DAVLEAFEARALRMAVtCAKNLSKFENQEQGFQELLADLVEAAIAHCQLIVVSKFIAKLEQDIGGKGVKKQLNNLCYIYA 560
302759741 484 SNLLYAFEARAARLAL-VATQLVQKAGNEAGFEQHSIELIEAARAHCELMVLSKFVERLQRGVPGRGVQRQLDILCEVYG 562
302785646 563 LFLLVSRAGDFLSTGCLTPTQVALAKQQLQNLYTEVRPNAVALVDAFGHTDHYLGSILGRYDGDVYPNLYKDAWEEPLNK 642
15227469  561 LYLLHKHLGDFLSTNSVTPEQASLANQQLRSLYSQVRPNAVALVDAFDYTDQYLGSVLGRYDGNVYPKLFEEALKDPLND 640
115465886 566 LYLVHKHLGDFLSTGSITARQGALANEQLGKLYAQVRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEAWKDPLND 645
168048513 562 FSQLIDNAGDFLATGYVTGNQIALAKEELKHMFDKIRPNAVALVDAFDHTDDYLGSALGRYDGDVYTHLYKGAFKESLND 641
240255949 561 LYLLHKHLGDFLSTNCITPKQASLANDQLRSLYTQVRPNAVALVDAFNYTDHYLNSVLGRYDGNVYPKLFEEALKDPLND 640
224071137 536 LNLLHKHLGDFLSTGCITPKQASLANDQLRSLYSQVRPNAIALVDAFNYTDHYLGSVLGRYDGNVYPKLYEEAWKDPLND 615
224138652 561 LNLLHKYLGDFLSTGCITPKQASLANDQLRSLYSKIRPNAIALADAFNYTDHYLGSVLGRYDGNVYPKLYEEAWKDPLND 640
242092078 564 LYILHKHLGDFLATGCITPKQGALANEQLGKLYAQVRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEAWKDPLNE 643
255568739 561 LNLLHKHQGDFLSTGCITPKQASLANDQLRSLYSQVRPNAIALVDAFNYTDHYLGSVLGCYDGNVYPKLYEEAWKDPLND 640
297823369 561 LYLLHKHLGDFLSTNSVTPEQGSLANRQLRSLYSQVRPNAVALVDAFDYTDHYLGSVLGRYDGNVYPKLFEEALKDPLND 640
297800438 561 LYLLHKYLGDFLSTNSITPKQASLANDQLRSLYSQVRPNAVALVDAFNYTDHYLNSVLGRYDGNVYPKLFEEAWKDPLND 640
302759741 563 LFLLVSRAGDFLSTGCLTPTQVALAKQQLQNLYTEVRPNAVALVDAFGHTDHYLGSILGRYDGDVYPNLYKDAWEEPLNK 642
302785646 643 TVVTDGYEEYIRPILKQEFLPsrkARL 669
15227469  641 SVVPDGYREYIRPLIKQRFRS---AKL 664
115465886 646 TDVPDGYQEHLRPLLKQQLKL---SRL 669
168048513 642 TVVVDGYEEYLKPVLTQNLWAp-hSKL 667
240255949 641 SVVPDGYQEYLRPVLQQQLRT---ARL 664
224071137 616 SVLPDGYNEYIRPMLKQQLHN---ARL 639
224138652 641 SVVPDGYHEYVHPMLKQQLRN---ARL 664
242092078 644 TVVPEGYHEYLRPLLKQQLKL---SRL 667
255568739 641 SVIPDGYNEYVRPMLKQQLRN---ARL 664
297823369 641 SVVPDGYHEYIRPLIKQRFRS---AKL 664
297800438 641 SVVPDGYHEYLRPVLKQQLRT---ARL 664
302759741 643 TVVTDGYEEYIRPILQQEFLTsrkARL 669
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap