Conserved Protein Domain Family
PLN02442

?
PLN02442: PLN02442 
S-formylglutathione hydrolase
Statistics
?
PSSM-Id: 178061
View PSSM: PLN02442
Aligned: 15 rows
Threshold Bit Score: 446.531
Threshold Setting Gi: 145353979
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145353979   2 APFNLKTISVTRAHHGTLHRLQHDSETLSSVATFAVFVPGaVEDfKDKFPLLLYLSGLTCTDENVAQKGCAFEHCHARRV 81 
159478839   2 ATPEVSEVAVNKQFGGFNRRYKHKSSSLGCEMTFTIYYPP-AAA-GGKVPVLYFLSGLTCNDENFITKAGAQRQAAARGV 79 
168021781   1 -------MSSNKVFGGFNRRYKHESSSVGCPMTFTIFFPP-AAD-SSKVPVLYWLSGLTCNDENFIQKSGAQRAAAAHGL 71 
224086942   1 METKPSEISSSKMFGGYNKRYKHFSPTLGCSMTFYIYFPPsPSP-SHKFPVLYWLSGLSCTDENFIAKSGAQRVASTEGI 79 
225441910   1 MEAKPTEISGSKMFGGYNKRFKHFSPTLGCSMTFHVYFPPlPSP-SHKFPVLYWLSGLSCTDENFIIKSGAQRVASSEGI 79 
225441912   1 MEAKPTEISGSKMFGGYNKRFKHFSPTLGCSMTFHVYFPPlPSP-SHKFPVLYWLSGLSCTDENFIIKSGAQRVASSEGI 79 
255565327   1 -----MKSVAQRCLEDTIK--------------------------DTDISILYFLSGLTCTDENFIIKSGAQRAASSEGV 49 
302810846   1 -MAQLKEIGKNKMFGGFNRRFQHPSSSCGCDMNFSVYFPP-AAD-HGKVPVLYWLSGLTCTDENFIQKSGAQRVAAAEGV 77 
302788871  29 PMAQLKEIGKNKMFGGFNRRFQHPSSSCGCDMNFSVYFPP-AAD-HGKVPVLYWLSGLTCTDENFIQKSGVQRVAAAEGV 106
297827797   1 MDSGLSEIGSTKMFDGHNKRYKHYSETLGCSMTFSIYFPPsASS-SHKSPVLYWLSGLTCTDENFIIKSGAQRAASTHGI 79 
145353979  82 AMVMPDTSPRG-DDAADDEAWDLGKGAGFYVDASAAPWsRHYKTYSYVTKELPKVLraCDFADALDHERVSISGHSMGGH 160
159478839  80 ALIAPDTSPRGlGVEGESESWDFGVGAGFYVNATQPKW-KNWRMYEYVTEELPALLraAPLGSSLDLDRASVFGHSMGGH 158
168021781  72 ALVAMDTSPRGlNVEGESDSWDFGTGASFYLNATQEKW-KNWRMYDYVTKELPSLL--SSHFPQLDTSNASLFGHSMGGH 148
224086942  80 VLIAPDTSPRGlNVEGEADSWDFGVGAGFYLNATQEKW-KNWRMYDYVVKELPKLL--SENFPQLETSKASIFGHSMGGH 156
225441910  80 ALVAPDTSPRGlNVEGEADSWDFGVGAGFYLNATQEKW-KNWQMYDYVVKELPKVL--SENFAQLDTSRASISGHSMGGH 156
225441912  80 ALVAPDTSP----------------SAGFYLNATQEKW-KNWQMYDYVVKELPKVL--SENFAQLDTSRASISGHSMGGH 140
255565327  50 ALIAPDTSPRGlNVEGEADSWDFGVGAGFYLNATQEKW-KNWRMYDYVVKELPKLL--SDNFPQLDTSRASLSGHSMGGH 126
302810846  78 AIVCPDTSPRGlGVEGESDSWDF--GAGFYLNATQEKW-KKWRMYDYCTKELPELL--RSSFDQLDTKNASIFGHSMGGH 152
302788871 107 AIVCPDTSPRGlGVEGESDSWDFGVGAGFYLNATQEKW-KKWRMYDYCTKELPELL--SSSFDQLDTKNASIFGHSMGGH 183
297827797  80 ALVAPDTSPRGlNIEGEADSYDFGVGAGFYLNAAQEKW-KNWRMYDYVVKELPKLL--SENFSQLDTTKASISGHSMGGH 156
145353979 161 GALTLALRNPNAYASASAFAPIANPTasDCPWGQKALKAYLGSADCDeAKSHDATELVKSVEagTFKMPILIDQGAADSF 240
159478839 159 GALVVGLRNPTRFRTISAFSPISNPI--NAPWGVKAFTGYLGEDKAA-WKEYDASELLRGFNg-DVKPAILVDTGSADKF 234
168021781 149 GALTLFLKNPSKYKSVSAFAPICNPT--ACPWGVKAFNGYLGAEKSA-WEEYDATLLVTKYN--GPKTTILIDQGDADKF 223
224086942 157 GALTIYLKNLDKYKSVSAFSPVANPI--NCPWGQKAFTNYLGPSKAD-WEEYDATSLVSKVH--DVSATILIDQGDEDKF 231
225441910 157 GALTIYLKNLDKYKSVSAFAPIVNPM--NCPWGQKAFTNYLGGNKAD-WEEYDATCLISKFN--DVSATILIDQGEDDKF 231
225441912 141 GALTIYLKNLDKYKSVSAFAPIVNPM--NCPWGQKAFTNYLGGNKAD-WEEYDATCLISKFN--DVSATILIDQGEDDKF 215
255565327 127 GALTIYLKNLDKYKSVSAFAPISNPI--NCPWGQKAFTNYLGSSKGD-WEEYDATSLVSKFH--DVSATILIDQGEDDKF 201
302810846 153 GALTIFLKNPDKYKSVSAFAPIANPV--NCPWGQKAFSGYLGDDKSL-WEEYDASLLSRKYK--GHPTKILIDQGDDDKF 227
302788871 184 GALTIFLKNPDKYKSVSAFAPIASPV--NCPWGQKAFSGYLGDDKSL-WEEYDASLLSRKYK--GNPTKILIDQGDDDKF 258
297827797 157 GALTIYLKNLDKYKSVSAFAPIANPI--NCAWGQKAFTNYLGDNKAT-WEEYDATCLISKFN--NLSATILIDQGESDQF 231
145353979 241 YKT-QLHPERFVDAAKERG-CDVTYRLHDGYDHSYFFVSTFMREHIEFHAAALGS 293
159478839 235 LTE-QLKPDSLEAAAKESGyGNVTVRMQDGYDHSYFFISSFIDDHINFHADALTK 288
168021781 224 YKEnQLLPENFEQACKSAG-MPIDMRIQPGYDHSYFFIASFVEDHIQHHAKALSV 277
224086942 232 LHD-QLLPNKFEEACRSAN-VSVLMRLQPGYDHSYFFIATFIDDHIHHHAHALKL 284
225441910 232 LHD-QLLPHKFEEACKNAK-VPLLLRLQPGYDHSYYFIATFIDHHIQHHAQALNM 284
225441912 216 LHD-QLLPHKFEEACKNAK-VPLLLRLQPGYDHSYYFIATFIDHHIQHHAQALNM 268
255565327 202 LHDkQLLPQKFEEACRSAN-VPLLLRMQPGYDHSYFFISTFIDDHIRHHAQALNL 255
302810846 228 YKEkQLLPQNIVESEL----LRVELHLRSGYDHSYFFIASFVEDHIKMHARALKS 278
302788871 259 YKEkQLLPENIVESEL----LRVELHLRSGYDHSYFFIASFVEDHIKMHATALKS 309
297827797 232 YPD-QLLPSNFEEACKKVN-APLLLRLQPGYDHSYYFIATFIEDHISHHAQALKL 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap