Conserved Protein Domain Family
PLN02438

?
PLN02438: PLN02438 
inositol-3-phosphate synthase
Statistics
?
PSSM-Id: 178057
View PSSM: PLN02438
Aligned: 24 rows
Threshold Bit Score: 978.06
Threshold Setting Gi: 219116747
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168020111   1 MLVDSFRVE---SPHVEYTEDM------IKSSYEYQTTEFL-HEQRksDGKYEWVAKPKSVPYQFATQRKVPKLGMMLVG 70 
145342099   1 MLIDKFTVE---SATVRTIEDGatgieyVESEHAYASTRVErRTSTsvEGKECFALVPETKNFTIRTRTSVPKVGIMLVG 77 
159490574   1 MLVDSFEVQ---SPNVVYSDEH------ITSTYDYASTKLD-RAPD-----GKWVVKPTSTSYQFRVDRRVPKLGVMLVG 65 
219116747   6 HLEGEFTVQ---SKNCQYNADT------IISDYTYETTIVE-GN----------VVKPVKSKMKFRTERKVPKLGVMLVG 65 
168055751   1 MLVDSFRVD---SPHVEYTDDA------IRSTYEYQTTEFL-HEQKs-DGKYEWVAKPKSVPYQFITERKVPKLGMMLVG 69 
255071143   1 MLIDNFTVR---SPDVTYTDTH------IESKYTYTSTDLN-CEDLg-DGRCAWTISPVESDFHFSTDRRIPRLGIMLVG 69 
303273684   8 DFVGRSPLPqllAKSVRFLS--------LLFLYRYHDTKLT-SEDLg-AGKSAWTVEPIETRFHFKVNRHAPKLGIMLVG 77 
302830640   1 MLVDSFEVQ---SPNVVYSDEF------ITSTYDYASTKLD-RAP---DG--KWVVKPTNSTYQFRVDRRVPKLGVMLVG 65 
302775228   1 MFIESFRVE---SPNVKYSEEH------ISSVYDYNTTDLV-HEKNr-EGKYEWVVKPSTVTYEIQTQRKVPKLGIMLVG 69 
302757273   1 MFIESFRVE---SPNVKYSEEH------ISSVYDYNTTDLV-HEKNr-EGKYEWVVKPSTVTYEFQTQRKVPKLGIMLVG 69 
168020111  71 WGGNNGSTLTAGILANKEGISWVTKDGVQHANYFGSLTQASTCRVGS-FQGEEIHVPFKSILPMVNPNDLVIGGWDISNM 149
145342099  78 WGGNNGSTLTAGMLANKHDVTWNTKDGVRKPNYYGSLTQSGTCRVGH-LEGEEVYVPFKSLMPLANPNDVIVDGWDINDA 156
159490574  66 WGGNNGTTLTAGILANKHGITWMTKDGLKKPNFYGSLTQAATVRVGN-FEGEEVYAPFKALLPMVEPNDIVLGGWDISGL 144
219116747  66 LGGNNGCTCVAGAIANKLGMTWETKEGKLKANYWGSVMMASTAKIGNdTHGNAVYTPLRNMLPMANPNEIVWGGWDINGM 145
168055751  70 WGGNNGSTLTAGILANREGISWVTKDGVQHANYFGSLTQASTCRVGA-FQGEEIHVPFKSILPMVDPNDLVIGGWDISNM 148
255071143  70 LGGNNGSTLVGGVIANREGITWKTKEGVRVPNYFGSLTQSSTCRVGS-VKGQEVFTPFKTLLPMVNPNDIVFDGWDISGM 148
303273684  78 LGGNNGSTLTAGVIANREGITWKTKEGVRVPNYWGSLTQASTCRVGA-INGQEAYVPFKSLLPMAEPNTIVFDGWDISDM 156
302830640  66 WGGNNGTTLTAGILANKHGITWMTKDGLKKPNFYGSLTQAATVRVGN-YEGEEVYAPFKALLPMVEPTDIVLGGWDISGM 144
302775228  70 WGGNNGSTLTAGIIANREGISWVTKDGVQRPNYFGSVTQASTCRIGS-FRGEEIYAPFKSLLPMVNPDDVVLGGWDINNM 148
302757273  70 WGGNNGSTLTAGIIANREGISWVTKDGVQRPNYFGSVTQASTCRIGS-FRGEEIYAPFKSLLPMVNPDDVVLGGWDINNM 148
168020111 150 NLADAMDRARVLDIDLQKQLRPLMQDMVPMPGIYDPDFIAANQEARANNLIKGSKKEQMERIIQDIRNFKAQTKVDKVVV 229
145342099 157 NLADAMERAKVLDFDLQRQLRPRMEGMRPRASVFDPKFVARNQLSRANNVIGGSKTEQMAQIRADIRDFKEKNGIDSVVV 236
159490574 145 NLAEAMERAKVLDWTLQEQMVPYMREMVPLPGIYDPDFVAANQEERADNLIKGTKSEQLAVVRQQIRAFKEANQVDKIVV 224
219116747 146 NLGEAMKRSKVLDIDLQNQLYPHMKNITPLPSVYFSDFIAANQGERANNVIKGTKQEQLDQLRNDIRNFKTNNGLDKVIL 225
168055751 149 NLADAMDRARVLDIDLQKQLRPLMQDMVPMPGIYDPDFIAANQEARANNLIKGTKKEQMEKIIQDIRDFKAQNKVDKIVV 228
255071143 149 NLADAMERAKVFDWDLQRQLAPYMKNMKPRPGIYDPNFIAANQSARADNCLKGSKREQMERIRADLRDFREKNALDKIVV 228
303273684 157 NLADAMERAAVLDWDLQRQLTPHMKKIVPRPGIFDPKFIAANQEIRANNCIKGTKQEQMDQIRHDINDFKTTSGVDKVVV 236
302830640 145 NLAEAMERSKVLDWTLQEQLVPYMRDMVPLPGIYDPDFVAANQEERADNLIKGSKREQMETVRQQIRAFKESNSLDKVVV 224
302775228 149 NLADAMERAKVLDMDLQKQLRPYMDKMVPLPGVYDPDFIAANQGSRANNIFKGSKKEKMDKIIEDIRHFKSQTKVDKVVV 228
302757273 149 NLADAMERAKVLDMDLQKQLRPYMDKMVPLPGVYDPDFIAANQGSRANNIFKGSKKEKMDKIIEDIRHFKSQTKVDKVVV 228
168020111 230 LWTANTERYSDVIVGLNDTKENLFDSLEKGENEISPSTLYALACIHEQVPFINGSPQNTFVPGVIEYAVEKNSLIGGDDF 309
145342099 237 LWTANTERYSETREGVHDTEENLRNAIKTGEEEISPSTLFALACIDEHTPFINGSPQNTFVPGVVQAAVRLNSIIGGDDF 316
159490574 225 LWTANTERFAQVVEGLNDTADNLLASIERNEAEIAPSTLYAVACVQEGVPFVNGSPQNTFVPGMIDLAVKHNVLIGGDDF 304
219116747 226 LWTANTERFASIEEGVNDTADNLLESIMRGEAEVSASTVFAVASILEGSTFINGSPQNTFVPGVLELARQHKVFIAGDDF 305
168055751 229 LWTANTERYSDVIVGLNDTKDNLFASLEKGEKEISPSTLFALACIHEQVPFINGSPQNTFVPGVIEYAVEKKSLIGGDDF 308
255071143 229 LWTANTERYSEILIGLNDDEKSLRSSVDKNEPEISPSTLYALACIDEGVPFINGSPQNTFVPGLIDAAVRLNTIIGGDDF 308
303273684 237 LWTANTERYSELVVGLNDTEENLRHSIKNGELEVSPSTLMALACIDEGVPFINGSPQNTFVPGVVEAAVRLKSLIGGDDF 316
302830640 225 LWTANTERFAQVMEGLNDTADNLMAAIDRNEAEIAPSTLYAAACVLEGVPFVNGSPQNTFVPGMIELAVKHNVLIGGDDF 304
302775228 229 LWTANTERYSDVIVGLNDTKENLFASLERDEPEISPSTIYALACIQEGVPFINGSPQNTFVPGVIDFAVEKGTLIGGDDF 308
302757273 229 LWTANTERYSDVIVGLNDTKENLFASLERDEPEISPSTIYALACIQEGVPFINGSPQNTFVPGVIDFAVEKGTLIGGDDF 308
168020111 310 KSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNSILYAPGEHPDHVIVIK 389
145342099 317 KTGQTKMKSVLVDYLIGAGLKPTSIVSYNHLGNNDGLNLSAPQTFRSKEISKANVVSDMVASNPLLYDEGEEPDHTVVIK 396
159490574 305 KSGQTKLKSVLVDFLVGAGIKPTSIVSYNHLGNNDGLNLSAPQTFRSKEISKSNVVDDMVASNSILYAPGEHPDHCVVIK 384
219116747 306 KSGQTKMKSVLVDFLVSAGIKPVSIVSYNHLGNNDGKNLSAPSQFRSKEISKSNVVDDMVASNRILFEEDEHPDHVVVIK 385
168055751 309 KSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNSILYAPGEHPDHVIVIK 388
255071143 309 KSGQTKMKSVLVDFLVGAGIKPASIVSYNHLGNNDGMNLSAPNCFRSKEISKSNVIDDVVSSNSLLFRPGEHPDHVVVIK 388
303273684 317 KSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNSILYKPGERPDHVVVIK 396
302830640 305 KSGQTKLKSVLVDFLVGAGIKPTSIVSYNHLGNNDGLNLSAPQTFRSKEISKSNVVDDMVASNSILYAPGEHPDHVVVIK 384
302775228 309 KSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILFKPGEHPDHVIVIK 388
302757273 309 KSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILFKPGEHPDHVIVIK 388
168020111 390 YVPYVGDSKRAMDEYTSEIFMGGRNTIVMHNTCEDSLLAAPLILDLVLLAELCTRIQFKEDGQeKFHSFHPVAVLLSYLT 469
145342099 397 YVPNVGDSKRAMDEYTSAIFMNGENTIVMHNTCEDSLLAAPLILDLCLVAELLTRVEVKCEGE-QFHSIHPIAVLLSYWS 475
159490574 385 YVPYVGDSKRAMDEYTSEIFMGGRNTLVIHNTCEDSLLAAPIILDLVLLAELVTRIHLKKDGEeAFHGLHPIAVLLSYLT 464
219116747 386 YVPYVADSKRAMDEYTSEIFMGGKNTIVMHNTCEDSLLATPLIYDLVILGELCERITVKKEGSeDWEAFHPVLSLLSYML 465
168055751 389 YVPYVGDSKRAMDEYTSEIFMGGRNTIVMHNTCEDSLLAAPLILDLVLLAELCTRIQFKEDGQeKFHSFHPVAALLSYLT 468
255071143 389 YVPYVGDSKRAMDEYTSEIFMGGTNTIVMHNTCEDSLLAAPLILDMCLIAELSTRIKIKGPDDeQLRGLHPVSSLLSYLT 468
303273684 397 YVPNVGDSKRAMDEYTSEIFMGGRNTIVIHNTCEDSLLAAPLILDMCLIAELSTRIEVKSDGE-EYRSLHPISVLLSYLT 475
302830640 385 YVPYVGDSKRAMDEYTSEIFMGGRNTLVIHNTCEDSLLAAPIILDLVLLAELITRINLKKDDEdAFRGLHPIAVLLSYLT 464
302775228 389 YVPYVGDSKRAMDEYTSEIFMGGRSTIAMHNTCEDSLLAAPLILDLVLLAELCSRIQLKREGEeKFHSFHPVAALLSYMT 468
302757273 389 YVPYVGDSKRAMDEYTSEIFMGGRSTIAMHNTCEDSLLAAPLILDLVLLAELCSRIQLKREGEeKFHSFHPVAALLSYMT 468
168020111 470 KAPLVPPGTPVVNALAKQRAMLENIMRACIGLSPDNNMMLEYK 512
145342099 476 KAPLVPNGMPIVNALAKQRAMLENFFRAAVGLAPENNMLLEYF 518
159490574 465 KAPLVPYGTPVVNALAKQRAMLENIMRACVGLAPDNNMLMEFK 507
219116747 466 KAPLVPNGAPVVNALFTQREAVINVMRACLGLGPNNHMTLEHR 508
168055751 469 KAPLVPPGTPVVNALAKQRAMLENIMRACIGLSPDNNMMLEYK 511
255071143 469 KAPLVPKGTPVVNALSKQRAMLENVFRACIGLAPDNNMLLEYK 511
303273684 476 KAPLVPSGTPVVNALAKQRAMLENIFRACIGLAPENNMLLEHK 518
302830640 465 KAPLVPYGTPVVNALAKQRAMLENILRACVGLAPDSQMLLEFK 507
302775228 469 KAPLVPPGTPVINALSKQRACLENVLRACIGLAPENNMLLEYK 511
302757273 469 KAPLVPPGTPVINALSKQRACLENVLRACIGLAPENNMLLEYK 511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap