Conserved Protein Domain Family
PLN02437

?
PLN02437: PLN02437 
ribonucleoside--diphosphate reductase large subunit
Statistics
?
PSSM-Id: 178056
View PSSM: PLN02437
Aligned: 26 rows
Threshold Bit Score: 1417.2
Threshold Setting Gi: 297837607
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15227096    1 MYVVKRDGRQETVHFDKITARLKKLSYGLSSDHCDPVLVAQKVCAGVYKGVTTSQLDELAAETAAAMTCNHPDYASLAAR 80 
219110871   3 MYVLKRNGRRESVHFDKITSRVSKLCYGLDAKHVDPVIISQKVIQGVYPGVTTSELDELAAQTAASFATQHPDYSILAAR 82 
159485006   4 MYVLKRDGRQEPVMFDKITARIVKLAYGLNPDFCDAVLVAQKVAGGVYKGVTTSELDELAAETAAALTSTHPDYAILAAR 83 
145340510   4 LYVVKRDGREEPVAFDKITARIKKLAYGLSQEFCDPVIVAQKVCMGVFAGVTTKELDELAAETAASMTSKHPDYAQLAAR 83 
223999029   1 MYVVKRDGKKQSCQFDKIQSRISKLCYGLDQKFVNEAVISQKVIQGVYPGVTTTELDELAAQTAASFSTQHPDYAVLAAR 80 
224001624   1 MYVTKKDGRLELLDKNKILQRLQSLSTNLSTPYLSLPTLATSILHGTYPNLPTREIDTLASETAASMSTQHPDYGRLAAR 80 
255070623   3 MYVVKRDGRQEPVHFDKITARINKLAYGLNQEFCDPVLVAQKVAVGVYKGVTTSELDELAAETAASMTSKHPDYAQLAAR 82 
302793891   1 MYVIKRDGKQEAVHFDKITARLKKLSYSLNPDYCDPVIVAQKVCAGVYKGVTTSQLDELAAETAASMTTSHPDYAILAAR 80 
302844064   4 MYVIKRDGRQEPVMFDKITARIVKLAYGLNPDFCDAVLVAQKVAGGVYKGVTTSELDELAAETAAALTSTHPDYAILAAR 83 
302805775   1 MYVIKRDGKQEAVHFDKITARLKKLSYSLNPDYCDPVIVAQKVCAGVYKGVTTSQLDELAAETAASMTTSHPDYAILAAR 80 
15227096   81 IAVSNLHKNTKKSFSETIKDMFYHVNDRSGLKSPLIADDVFEIIMQNAARLDSEIIYDRDFEYDYFGFKTLERSYLLKVQ 160
219110871  83 VSVSNLHKMTIARFSDLVEVFYNYKHPKTGEPASLISEEVYQIVQKHKDELDGAIVHARDFEYDYFGFKTLEKSYLLKVD 162
159485006  84 IAVSNLHKNTEKSFSKTMDKLYTYRNPRNGEEAALIAKDVYDIIVQNAQRLDSEIRYDRDFDYDYFGFKTLERSYLLRID 163
145340510  84 IAVSNLHKTTKKSFSETMTQMYEHVNERNGKWSPLLADDVYEIIKANAERLDAEIVYDRDFEYDYFGYKTLERSYLLRID 163
223999029  81 IEVSNLHKETEKQFSKVVEAFYNYTHPKTGEPAPLVSKEVYDVVNANKDVLDGAVIHDRDFEFDYFGYKTLEKSYLLKLH 160
224001624  81 ICASANHKSTPDSFSKAMLLL-------NEEGGGFVNNEIADLVKRRGKEIDDRIKHERDFEMTYFGYKTLERSYLLKLN 153
255070623  83 IAVSNLHKNTLKSFSETMKVMYEHVNKRNGKWSPLLADDVYEIIKENADRFDSEIVYDRDFDYDYFGYKTLERSYLLRVD 162
302793891  81 IVVSNLHKKTKKSFSETVKEMYSHVDERSGLKAPLIANDVYDIIMKNAAKLDSEIIYDRDFDYDYFGFKTLERSYLLKVN 160
302844064  84 IAVSNLHKKTKKSFSETMEALYNYKNPRTGQEASLIDKEVFQIIIQNAARLNSEIRYDRDFDFDYFGFKTLERSYLLRMN 163
302805775  81 IVVSNLHKKTKKSFSETVKEMYSHVDERSGLKAPLIANDVYDIIMKNAAKLDSEIIYDRDFDYDYFGFKTLERSYLLKVN 160
15227096  161 -GTVVERPQHMLMRVAVGIH-KDDIDSVIQTYHLMSQRWFTHASPTLFNAGTPRPQLSSCFLVCMKDDSIEGIYETLKEC 238
219110871 163 -GKIAERPQLMLMRVSVGIH-GDDIPRVIETYNFLSERYFTHATPTLFNAGTNMPQMSSCFLMTMKEDSIDGIYDTLKNC 240
159485006 164 -GKVVERPQHMLMRVAVGIH-KEDIESAITTYHAMSERWFTHASPTLFNGGTPRPQLSSCFLLAMRDDSIDGIYDTLKEC 241
145340510 164 -GKVVERPQHLLMRVSIGIH-KEDIEKAVDTYHMLSERWMTHASPTLFNAGTPRPQLSSCFLIAMKEDSIEGIYDTLKEC 241
223999029 161 -GEIAERPQHMLMRVSVGIH-MGDIERVLETYNLLSQRFFTHATPTLFNAGTPNPQMSSCFLTCIKADSIDGIYDTLKNC 238
224001624 154 eDTIVERIQYLWMRVALGIHcYANLQAAFETYDLMSRGYFTHASPTLFHAGTTHPQLSSCFLVQMSDDSINGIYDTLKRC 233
255070623 163 -GKIVERPQHLLMRVAIGIH-K-DVEKAIDTYHMLSERWMTHASPTLFNSGTPRPQLSSCFLIAMKEDSIEGIYDTLKEC 239
302793891 161 -GRVVERPQHMLMRVSVGIH-KEDIEAAIKTYHLMSQRWFTHASPTLFNAGTPRPQLSSCFLLCMKEDSIEGIYDTLKEC 238
302844064 164 -GEVVERPQQMLMRVAVGIH-KDDIESAIQTYHAMSERWFTHASPTLFNSGTPRPQLSSCFLLCMRDDSIDGIYDTLKEC 241
302805775 161 -GRVVERPQHMLMRVSVGIH-KEDIEAAIKTYHLMSQRWFTHASPTLFNAGTPRPQLSSCFLLCMKEDSIEGIYDTLKEC 238
15227096  239 AVISKSAGGIGVSVHNIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAVYLEPWHADVYEFLELRKNH 318
219110871 241 AVISKYAGGIGLAIHNVRASQSYIRGTNGSSNGIVPMLRVFNNTARYVDQGGGKRKGSIAIYLEPWHADVFAFLDLRKNH 320
159485006 242 AVISKSAGGIGLSIHCIRGTGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAIYMEPWHADVFDFLDLRKNH 321
145340510 242 ACISKSAGGIGLSIHDIRATSSYIRGTNGTSNGIIPMLRVFNDTARYVDQGGGKRKGAFAIYIEPWHADIFDWLDLRKNH 321
223999029 239 AVISKYAGGIGMSISNVRASASYIRGTNGTSNGIVPMLRVFNNTARYVDQGGGKRKGSIAAYIEPWHADIFAFLDLRKNH 318
224001624 234 AVISKAAGGIGLCVHKIRARGTFIKGTRGVSNGLVPMLRVFDVTSHYVDQGGGKRPGAFAIYLEPWHADIFDVLNLKKNH 313
255070623 240 ACISKSAGGIGLSIHDIRATSSYIRGTNGTSNGIIPMLRVFNDTARYVDQGGGKRKGAFAIYLEPWHADIFDWLDLRKNH 319
302793891 239 AVISKSAGGIGLSVHNIRATNSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRK------------DVFDWLDLKKNH 306
302844064 242 AVISKSAGGIGLSIHCIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAIYIEPWHADVFEFLDLRKNH 321
302805775 239 AVISKSAGGIGLSVHNIRATNSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAIYLEPWHADVFDWLDLKKNH 318
15227096  319 GKEEHRARDLFYALWLPDLFMERVQNNGQWSLFCPNEAPGLADCWGAEFETLYTKYEREGKAKKVVQAQQLWYEILTSQV 398
219110871 321 GNESDRARDLFFAMWVPDLFMKRVKDNGTWSLLCPNECPGLADCFGDEFEALYERYEREGKVRQTIKAQQLWFAILDSQV 400
159485006 322 GKEEARARDLFYGLWIPDLFMERVEADKEWSLFCPNEAPGLADCWGEEFERLYLKYEQEGRSRRVVRAQQLWFAILEAQV 401
145340510 322 GKEEARARDLFYGLWTNDLFMKRVEANGDWTLMCPNECPGLADCWGEEFETLYQKYEAEGKGKKTIKAQQLWFAILESQV 401
223999029 319 GNEMERARDLFYALWIPDLFMQRVEQNGDWTLMCPNECPGLDTCWGEEFKTLYEKYEREGKGRKTIKAQQLWFAVLDSQV 398
224001624 314 GKEEQRARNLFYGLWVPDLFMKRVEEDGVWSLMCPHRCPGLSECHGEKFEELYAKYESDGRYTRQVRARELWAAILEAQI 393
255070623 320 GKEEARARDLFYGLWTNDLFMKRVEANGEWTLFCPNEAPGLADCWGEEFEALYEKYEAEGKGKKTVKAQQLWFAILESQV 399
302793891 307 GKEENRARDLFYGLWIPDLFMERVRSNSDWSLFCPNEAPGLADCWGEEFESLYTRYEREGRAKRSLSAQKLWFAILESQM 386
302844064 322 GKEEARARDLFYGLWIPDLFMERVEADKEWSLFCPNEAQDLAECWGADFERLYTQYEREGRARKVVRAQQLWFAILEAQV 401
302805775 319 GKEENRARDLFYGLWIPDLFMERVRSNSDWSLFCPNEAPGLADCWGEEFESLYTRYEREGRAKRSLSAQKLWFAILESQM 398
15227096  399 ETGTPYMLFKDSCNRKSNQQNLGTIKSSNLCTEIIEYTSPTETAVCNLASIALPRFVREKGVPLD---SHPPKLAGSLDS 475
219110871 401 ETGTPYMLFKDHCNRKSNQQNLGTIKCSNLCTEIVEYTAPDEAAVCNLASISLSKLV-----------------VPGQYG 463
159485006 402 ETGNPYMLYKDHCNRKSNQQNLGTIKCSNLCTEIIEYTSPDEIAVCNLASIALPRFVRERGSQPG---WESKKLVGSLDA 478
145340510 402 ETGNPYMLFKDACNRKSNQQNLGTIKSSNLCTEIVEFTSPEETAVCNLASIALPRFVIENNPSSPtgrTEVKKLVGSLKA 481
223999029 399 ETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTAPDEIAVCNLASISLSKF------------VTPADNFGGEG- 465
224001624 394 ETGTPYLLYKDAANKKSNQQNLGTIQCSNLCTEIIQYTNEEEVAVCNLASICLPKFVVSDR-----------GNFGSTEG 462
255070623 400 ETGNPYMLFKDACNRKSNQQNLGTIRSSNLCTEIVEYTSPEETAVCNLASIALPRFVIENNPQSPtgrTEAKKLRGSIGA 479
302793891 387 ETGNPYMVFKDTCNRKSNQQNLGTIKCSNLCTEIVEYTSPSETAVCNLASIALPRFVREQGINSE------TKLVDC--- 457
302844064 402 ETGNPYMLYKDSCNKKSNQQNLGTIKCSNLCTEIIEYTSPDEIAVCNLASIALPRFVRERGSQPG---WESKKLVGSLDA 478
302805775 399 ETGNPYMVFKDTCNRKSNQQNLGTIKCSNLCTEIVEYTSPSETAVCNLASIALPRFVREQGINSE------TKLVGSKGC 472
15227096  476 KNRYFDFEKLAEVTATVTVNLNKIIDVNYYPVETAKTSNMRHRPIGIGVQGLADAFILLGMPFDSPEAQQLNKDIFETIY 555
219110871 464 QGGSFDFEKLREVSGVVTKNLNRIIDRNFYPIEEARRSNMRHRPIGIGVQGLADCFQMLRIPFDSPEARKLNTDIFETIY 543
159485006 479 ANRFFDFEKLAEMTKMVTRNLNKIIDVNYYPHPKAQRSNMRHRPIGLGVQGLADTFILLGMAFDSPEAAELNRQIFEVVY 558
145340510 482 KERYFDHDKLFEITRKVTRNLNRIIDVNYYPVETAKRSNMRHRPIGLGVQGLADVFILLGLAFDSPEAQKLNAEIFETIY 561
223999029 466 ---HFDLENLKHISKVVTKNLNRVIDRNFYPVEEARRSNMRHRPIGIGVQGLADAFMMMKLPFESPEARQLNKDIFETIY 542
224001624 463 SGAYFDHEQLHKVAKIVTKNLDKVIDVNQYPIEGAKKSNRSHRPVGIGVSGLADTFLRLGLPFASEEAKTLNEAIFETIY 542
255070623 480 ANRYFDHDKLAEITRKVTRNLNRIIDVNYYPVETARRSNMKHRPIGLGVQGLADVFILLGMPFDSPEAKKLNAEIFETIY 559
302793891 458 ----------FQVTTVVTENLNKIIDINYYPVDTAKRSNLRHRPIGIGVQGLADAFILLGLPFDSEEARDLNKDIFETIY 527
302844064 479 PNRFFDFEKLAEMTQMATRNLNKIIDVNYYPHPKAQKSNMRHRPIGLGVQGLADTFIILGMPFDSPEAAELNRQIFEVIY 558
302805775 473 KNRVFDFHKLAEVTTVVTENLNKIIDINYYPVDTAKRSNLRHRPIGIGVQGLADAFILLGLPFDSEEARDLNKDIFETIY 552
15227096  556 YHALKASTELAARLGPYETYAGSPVSKGILQPDMWNVI--PS--------------------D-RWDWAVLRDMISKNGV 612
219110871 544 FGACTASCDLAAVDGHYESYPGSPSSKGQLQFDLWNVQ--PS--------------------N-RWDWASLKAKIAEHGI 600
159485006 559 HAALSTSCELAERDGPYETYAGSPVSQGVLQPDMWGVK--PTg------------------vDgRCNWEELRNRIAQHGV 618
145340510 562 FAALTESNALAVVEGPYTTYEGSPVSKGILQPDMWGLTqmPG--------------------GdRHDWAGLRAAIAQHGV 621
223999029 543 FGACEASMELAEQEGPYETYEGSPASKGQLQFDMWGVE--PS--------------------N-LWDWAGLKAKIAQHGM 599
224001624 543 HASLEASNEIAREKGSYETFAGSPASEGKLQFNLWGVDdvETpshrkdqsalafqkystqvnGgGYDWETLRQNIIEGGL 622
255070623 560 FAALTESNDIAKRDGTYESYPGSPVSNGVLQPDMWGLTemPG--------------------GdRHDWTGLRTKISEHGV 619
302793891 528 YHAMKTSSVLAELYGVYETYPGSPVSKGVFQPDMWNVI--PS--------------------G-RWDWPALKEMVARHGV 584
302844064 559 YAALSASCELAERDGTYETYEGSPVSQGILQPDMWGVK--PTg------------------vGsRCDWPALRDRIARHGV 618
302805775 553 YHAMKTSSILAELYGVYETYPGSPVSKGVFQPDMWNVI--PS--------------------G-RWDWAALKEMVARHGV 609
15227096  613 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHLLHDLTDMGLWTPTLKNKLINENGSIVNVAEIP 692
219110871 601 RNSLLVAPMPTASTAQILGNNESTEPFTSNMYNRRVLAGEFTVVNKHLLRELTARGIWTENVRNRIIAENGSIQNVPEIP 680
159485006 619 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYVRRVLSGEFTVVNQHLLHDLNRMGIWSADLKNELVAANGSVLEL-EIP 697
145340510 622 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYARRVLSGEFTVVNQHLLSDLTELGLWDPELKNSLIANNGSVADL-EIP 700
223999029 600 RNSLLMAPMPTASTAQILGNNESTEPFTSNMYNRRVLAGEFTIVNKHLLRELTANGLWTERVRNQIIAQGGSVQAVADIP 679
224001624 623 RNSLLVAPMPTASTSQILGVNECFEPFASNLYVRRVKAGEFIIVNPHLIQDLTDLGLWNQSVRNQLMRDGGSVAKIECVP 702
255070623 620 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYARRVLSGEFTVVNQHLLSDLTEMGLWDPSLKNELIANNGSVQSL-DIP 698
302793891 585 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYTRRVLSGEFVVVNKHLLNDLTDLGIWTPDLKNKVMAYNGSIQSIEGIP 664
302844064 619 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYVRRVLSGEFTVVNQHLLHDLNRMGLWSPELKNELVAANGSVADL-DIP 697
302805775 610 RNSLLVAPMPTASTSQILGNNECFEPYTSNIYTRRVLSGEFVVVNKHLLNDLTDLGIWTPDLKNKVMAYNGSIQSIEGIP 689
15227096  693 DDLKAIYRTVWEIKQRTVVDMAADRGCYIDQSQSLNIHMDKPNFAKLTSLHFYTWKKGLKTGMYYLRSRAAADAIKFTVD 772
219110871 681 VEIREIFKTVWEIPQRAILDMAADRAPYICQSQSLNVHIADPNSKKLTSMHFYAWQKGLKTGMYYLRTRPKADAIKFTVD 760
159485006 698 EELKGLYKTVWEIKQRTLVDMAADRGAYIDQSQSFNVFMPDPNFGKLTSLHFYAWRKGLKTGMYYLRTKAAADAIKFTVD 777
145340510 701 ENLKAIYKTVWEIKQRILVDMAADRGAFIDQSQSFNVHMSDPNSGKLTSLHFYAWKKGLKTGMYYLRSRAAADAIKFTVD 780
223999029 680 KSIRDVYKTVWEIPQRAILDMAADRGAFICQSQSMNVHIGEPSTSKLTSMHFYAWKKGLKTGMYYLRTRPKADAIQFTVN 759
224001624 703 DRLKGLYKTVWEMKMKDVIDMAADRGKFIDQSQSLNLFIADPTVDKLTAMHFYAWKKGLKTGIYYLRTRPAVNAIQYTVE 782
255070623 699 DNLKEIYKTVWEIKQRILVDMAADRGAFIDQSQSFNVHMSDANSGKLTSLHFYAWKKGLKTGMYYLRSRAAADAVKFTVD 778
302793891 665 DDLKQIYRTVWEIKQRTIVDMAVERGAYIDQSQSLNIHMEQPTTTKLTSLHFHAWSGGLKTGMYYLRSQAAADAIKFTVD 744
302844064 698 VELKALYKTVWEIKQRTLVDMAADRGAYIDQSQSFNVFMPDPNFGKLTSLHFYAWRKGLKTGMYYLRTKAAADAIKFTVD 777
302805775 690 DDLKQIYRTVWEIKQRTIVDMAVERGAYIDQSQSLNIHMEQPTTTKLTSLHFHAWSGGLKTGMYYLRSQAAADAIKFTVD 769
15227096  773 TAMLKek---------------------------------------------------------pSVAEGDKEVEEEDNE 795
219110871 761 QEQLVsnkmkev-----------------------------------------------klvdkeNSSNMVTPPPPGATA 793
159485006 778 QQALSkkkttqgtsaataatpqmkmpsmsgnlgltpnitaaaaslpstsntpavsnggaaaggdtAAARRAAQLAQLERE 857
145340510 781 VKQKQ----------------------------------------------------------------VTKMSEEEKEA 796
223999029 760 QEMLAestskpa----------------------------------------------qdqlernPSPTSVTAAGKVSVN 793
224001624 783 KDALP------------------------------------------------------------------------EVD 790
255070623 779 PNSVKaknasskkevv--------------------------------------gdkenqpangeGAKKGPVDPDMEEEA 820
302793891 745 TASLKvgfy-----------------------------------------------------flrFYLTLSSVPESCKGN 771
302844064 778 QQALSrkk------------------------------------------------------asnPPPTLSLPTGKFSVG 803
302805775 770 TASLK-------------------------------------------------------------------SPTKTTDE 782
15227096  796 TKLAQMVCSLTNPEECLACGS 816
219110871 794 MKGTQGLTTEDEEDMCLSCGA 814
159485006 858 QQLAAMVCSLENKDACLMCGS 878
145340510 797 YLAAKLQCSLTNKDDCVMCGA 817
223999029 794 SKFAGLQMK-DEEEECLNCGA 813
224001624 791 ASPQQNIPTLDDSETCLSCSA 811
255070623 821 LMAAKIACSLANKDECVMCGA 841
302793891 772 RRRAISADGLLTRES------ 786
302844064 804 AQLAAMVCSLENKEACLMCGS 824
302805775 783 ELLAQMVCSLENRENCLACGS 803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap