Conserved Protein Domain Family
PLN02432

?
PLN02432: PLN02432 
putative pectinesterase
Statistics
?
PSSM-Id: 178051
View PSSM: PLN02432
Aligned: 8 rows
Threshold Bit Score: 548.282
Threshold Setting Gi: 242058123
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242058123   1 MLTTGSRSRQLVLLVDQSGKGDHRRIQDAIDAAPAggSGSggGGVVIRIKPGVY-RQVEKVVVDKPCITLVGTSASSTII 79 
15226598   39 SPSSIDFSTAILIRVDQSGKGDFSKIQEAIESIPPnlNNS--QLYFIWVKPGIY-REKVVIPAEKPYITLSGTQASNTFL 115
224077850  15 TTGSIDMSTAILIRVEQSGKGDFKKIQDAIDSVPS--NNS--ELVFIWVKPGTYsREKIVVPADKPFITLSGTQPSDTII 90 
225428450   1 ------MSTAILIRVDQSGNGDYGKIQDAIDAVPS--NNS--QLYFILVKPGTY-REKIVVPADKPFITLSGTQASTTII 69 
225458247  52 GASPGSLSTAILMRVDQSGKGDYQKIQDAIDAVPS--NNT--EVVFIWVKPGIY-REKIVVPADKPFITLSGTKATTTII 126
255543703  32 ATASIDLSTAILIRVDQSGKGDFKTIQDAIDSVPP--NNS--QLVFIWVKPGIY-RERVVVPADKPFITLSGTTASNTII 106
297825017  40 SSSSIDFSTAILIRVDQSGKGDFSKIQEAIESIPPnlNNS--QLYYIWVKPGIY-REKVVIPADKPYITLSGTQASNTFL 116
297597255  31 cscfaiAMPSVVVTVDQSGKGDHRRIQDAIDAAPA--NDS--SRTVIRIKPGVY-RRKVVV--DKPYVTLTGTSATSTVI 103
242058123  80 TWNESWVASESPTVSVLASDFIAKRLAFQNTFGSSGPAVAMRVAGDRAAFYGCRFVSFQDTLLDDTGRHYYRGCYVQGAT 159
15226598  116 IWSDGEDILESPTLTIFASDFVCRFLTIQNKFGTAGRAVALRVAADKAAFYGCVITSYQDTLLDDNGNHYFKNCYIEGAT 195
224077850  91 TWNDGGNIMESPTLTVLASDFVGRYLTIQNTFGSAGKAVALRVSGDRAAFYGCRILSYQDTLLDDTGSHYYSNCYIEGAT 170
225428450  70 TWGDGGEIFESPTLSILASDFVGRYLTIQNTFGTSSKAVAVRVSGDRAAFYNCRILSYQDTLLDDAGRHYYRNCYIEGAT 149
225458247 127 TWNDTGEIFDSPTFSVLATDFVGRFLTIQNTYGAGAKAVALRVSADRVAFFECRILSHQDTLLDDTGRHFYRNCFIQGDT 206
255543703 107 TWSAGGDIYESPTLSVLASDFVGRYLTIQNTFGSGDKAVALRVSGDKAAFYGCRILSYQDTLLDETGSHYYSNCYIEGAT 186
297825017 117 IWSDGGDILESPTLTIFATDFVCRFLTIQNKLGTAGRAVALRVAADKAAFYGCVITSYQDTLLDDNGNHYFKNCYIEGAT 196
297597255 104 AWNESWVSDESPTVSVLASDFVAKRLTFQNTFGDSAPAVAVRVAGDRAAFYGCRFVSFQDTLLDETGRHYYRGCYVQGAT 183
242058123 160 DFIFGNGKALFDKCHLHSVSAA--GGAFTAHKRWSESEDTGFSFVGCKLTglGAGTSILGRPWGPYSRVVFALSYMSSTV 237
15226598  196 DFICGSASSLYERCHLHSLSPN--NGSITAQMRTSATEKSGFTFLGCKLT--GSGSTFLGRPWGAYSRVVFAYSFFSNVV 271
224077850 171 DFICGNAASLFERCHLHSISTN--NGSITAQHRNLASENTGLVFLGCKIT--GAGTTFLGRPWGAYSRVLYAFTYMSGVI 246
225428450 150 DFICGSAASLFEKCHLHSLSEG--NGAITAQQRGSTSENNGFTFLGCKIT--GVGTPYLGRPWGPYSRVVFVLSFMSSVV 225
225458247 207 DFICGNAASLFEKCHLHSLSEE--SGAITAQRRESPAEDTGFIFLGCKLT--GLKSALLGRPWGDYSRVVFAFTYMSNAI 282
255543703 187 DFICGNAASLFEKCHLHSISRN--NGSITAQHRASQSDNTGFTFLGSKIT--GIGSAYLGRPWGAYSRVVFALSYMSGVI 262
297825017 197 DFICGSASSLYERCHLHSLSPT--KGSITAQMRTSATEKSGFIFLGCKLT--GSSSTYLGRPWGPYSRVIFAYSFFSNVV 272
297597255 184 DFIFGNGRALFDKCHLHSTSPDgaGGAFTAQQRSSESEETGYSFVGCKLTglGAGTSILGRPWGPYSRVVFALTYMSSTV 263
242058123 238 RPQGWDDWtdGDKQRQRTAFYGQYQCYGEGSKTDGRVAWSHDMSQAQAAPFITKGWVGGQEWLR 301
15226598  272 APQGWNQW--GDSTKENTVYYGEYKCYGPGADREQRVEWSKQLSDEEATVFLSKDFIGGKDWLR 333
224077850 247 APAGWDDW--ADPSKHSTVFYAEYKCYGPGADRSKRVGWSQSLSNDDAAPLLTKDMIGGSSWLR 308
225428450 226 QPQGWDDW--GDSNKQSTVYYGEYKCYGPGANRTERVEWSRSLSSDEAVPFLTKEMIGGQGWLR 287
225458247 283 LPQGWDDW--SDTSKQSTAFYGQYKCYGPGAITSKRVEWSRNLTSQEAAPFLTKNLIGGNSWIR 344
255543703 263 VPPGWDSW--SGQTRQSTVFYAEYKCYGPGVVKSKRVEWSHELSAEEAAPFLTKDMIGGQSWLR 324
297825017 273 APRGWNQW--GDSTKENTVYYGEYKCYGPGADRGQRVKWSKQLSDDEATVFLSKDFIGGKDWLR 334
297597255 264 RPQGWDDW--GDPSNQRTAFYGQYQCYGDGSKTDGRVAWSHDLTQAEAAPFITKAWVDGQQWLR 325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap