Conserved Protein Domain Family
PLN02431

?
PLN02431: PLN02431 
ferredoxin--nitrite reductase
Statistics
?
PSSM-Id: 178050
View PSSM: PLN02431
Aligned: 16 rows
Threshold Bit Score: 768.174
Threshold Setting Gi: 297599961
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219119472   3 SELSKFMLVCIGSATLLSACSNAFVSIAsfkss-------vsrsdRAYGTSHSSSALFSTEAKAK--------------- 60 
145351091   1 --MDAARGTATTATTVRRAVRARGGRAVretrgarardarrgtprAVVEPEGASAGDASASASAGdalkwqaedaaslra 78 
159477377   1 --MQSRQCLNRKASGARPCANSRSLTAR----------------------VLATAAPVAPSATPA--------------- 41 
168046727   3 GAMQTKMWRGELISTSTHFIGGTRLQPKlnqdarkptksencivrVSMEREVKAKAAVSPPA------------------ 64 
168049146   3 GTMQSQMWRGQVSGASLHFTGATRVQGNshqdlvyptqfhkhgvrASAEREVKAKAVAAPPT------------------ 64 
225428816   1 MASISVPFLSQAPTHLSNSTSLRLKTRI-----------------SATPTPTPTPTTVAPSSTAA--------------- 48 
224123494   1 MSSLSVRFLTPQLSPTVPSSSARPRTRL-----------------------FAGPPTVAQPAETG--------------- 42 
255555453   1 ---MSSLPSVRLLSPPLSSHSTRPTRST---------------------RIFAAGPTVVQPVEVQ--------------- 41 
302811448   3 AAASSLLFDCKLACGSPRQHQRRHGSRVrrgvvccnkdgsspapsRIVPRAVAEDAVDEITAAPA--------------- 67 
302796346   3 AAASSLLFDCKLACGSPRQHQRRHGSRVrrgvvccnkdgfspapsRIVPRAVAEDAVDEITAAPA--------------- 67 
219119472  61 ------------TLFDTVDERTGKPTGtSFLPADvvELA---AKGNPIEKAKLAKDGTSAFIDvyeyARKIREGEMTWEE 125
145351091  79 hneeaiakyanfPELDKPDAHVARDADgYYVVKE--EWR---KPTNPFEKLKLAKDPMRELIGmngiEEMAKASAADFKA 153
159477377  42 ------------SAPLPLPDGVGEHSG-LKHLPEaaRTRaldKKANKFEKVKVEKCGSRAWNDvfelSSLLKEGKTKWED 108
168046727  65 ------------VAADRLTPRVQERDG-YYVLKE--EFR---QGINPQEKIKLGKEPMKFFIE----NEIEELAKTPFAE 122
168049146  65 ------------IAADRLVPRVEERDG-YYVLKE--EFR---QGINPSEKIKIAKEPMKFFME----NEIEELAKTPFAE 122
225428816  49 ------------VDASRMEPRVEERGG-YWVLKE--KFR---EGINPQEKVKIEKDPMKLFIE----DGFNELASMSFEE 106
224123494  43 ------------VDAGRLEPRVEKKDG-YYVLKE--KFR---QGINPQEKVKIEKEPMKLFME----NGIEELAKLSMEE 100
255555453  42 ------------VDAERLEPRVEEKDG-YFVLKE--KFR---QGINPQEKVKIEKEPMKLFME----NGIEELAKLSMEE 99 
302811448  68 ------------LDAGRLVPRVKQIDN-YWVLKP--EFR---KGINPAEKIKIDKEPMKLFME----NGIEELAKKPFDE 125
302796346  68 ------------LDAGRLVPRVEQIDN-YWVLKP--EFR---KGINPAEKIKIEKEPMKLFME----NGIEELAKKPFDE 125
219119472 126 VEK-----ADLDTRLKYVGMLHRGKRTPGQFMMRLKVPNGIVNADQMRFYADCVSKYDEElGVVDITTRAniQLRGVKIE 200
145351091 154 WDEalndpDETDQRPKWAGLFHRRKGHYGRYMMRLKLPNGLINSTQMRYLASVIKKYGED-GCCDITTRQniQLRGVELK 232
159477377 109 LNL-----DDVDIRLKWAGLFHRGKRTPGKFMMRLKVPNGELTAAQLRFLASSIAPYGAD-GCADITTRAniQLRGVTME 182
168046727 123 LDSskpgkDDIDVRLKWLGLFHRRKHQYGRFMMRFKLPNGITNSTQTRFLAETISKYGKE-GCADLTTRQnwQIRGIMLE 201
168049146 123 LDSskagkDDIDVRLKWLGLFHRRKHQYGRFMMRFKLPNGITNSSQTRFLAETISKYGEY-GCADLTTRQnwQIRGIVLE 201
225428816 107 IEKskhtkDDIDVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTSSAQTRYLASAIRQYGKE-GCADVTTRQnwQIRGVVLP 185
224123494 101 IDKekstkDDIDVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSAQTRYLASVIRKYGKD-GCADVTTRQnwQIRGVVLP 179
255555453 100 IDQnkltkDDIDVRLKWLGLFHRRKQQYGRFMMRLKLPNGVTTSEQTRYLASVIRKYGKD-GCADVTTRQnwQIRGVVLS 178
302811448 126 IDAdkeskEDVDARLKWLGLFHRRKHQYGTFMMRLKLPNGSSTSSQVRYLASVIEKYGEK-GCADVTTRQnwQIRGVVLS 204
302796346 126 IDAdkeskEDVDARLKWLGLFHRRKHQYGTFMMRLKLPNGSSTSSQVRYLASVIEKYGEK-GCADVTTRQnwQIRGVVLS 204
219119472 201 DAPDIIDGLHARNQTSFQSALDSVRNMVGSPLAGIDDQEMVDTREFCNALNDLVsldpVTETRGNPMWGNLPRKFNIAVS 280
145351091 233 DAPEILRKLEELGMCSLQSGLDNVRNATGNPLAGFDPQEIVDTRPYTLAIQDYV----TGGGRGNPAIANLGRKWNVCVV 308
159477377 183 DSETVIKGLWDVGLTSFQSGMDSVRNLTGNPIAGVDPHELVDTRPLLRDMEAML----FNNGKGREEFANLPRKLNICIS 258
168046727 202 DVPSLLKGLESVGLSSLQSGMDNVRNAVGNPLAGIDPDEIVDTIPICQALNDYI----INRGKGNTEITNLPRKWNVCVV 277
168049146 202 DVPALLKGLESVGLSSLQSGMDNVRNPVGNPLAGIDPDEIVDTAPFCKVLSDYI----INRGQGNPQITNLPRKWNVCVV 277
225428816 186 DVPEILKGLSEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLSQFI----TANARGNTAFTNLPRKWNVCVV 261
224123494 180 DVPEILRGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLSQFI----TANSRGNPEFTNLPRKWNVCVV 255
255555453 179 DVPDILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLTQFL----TSNSQGNPAVSNLPRKWNVCVI 254
302811448 205 DVPQILKGLEEVGLSSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTKTLSDFI----ISNGRGNPSITNLPRKWNVCVV 280
302796346 205 DVPQILEGLEEVGLSSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTKTLSDFI----ISNGRGNPSITNLPRKWNVCVV 280
219119472 281 GSRDDFAHTHINDIGLQPCPHakTGEMGFNVVLGGYMSIKRVAEAISANMWIKADreSVVTLSEAILRIFRDESERKDRQ 360
145351091 309 GSSDFFEHPDINDLAFIPAMK--DGKFGFNMIVGGFISSQRAAESVSLDAWIPEN--ELVAATHAVLTTFRDYGHRGNRQ 384
159477377 259 STRDDFPHTHINDVGYEAVAKp-NGEVVYNVVVGGYFSIKRNIMSIPLGCSITQD--QLMPFTEALLRVFRDHGPRGDRQ 335
168046727 278 GTHDLFEHPHINDLAYVPATK--NGVFGFNILVGGFFSSKRCAEAIPMDAWVPTD--DVVPLCKAILETYRDLGTRGNRQ 353
168049146 278 GTHDLFEHPHINDLAYMPATK--NGVFGFNILVGGFFSPKRCAEAIPMDAWVPAD--DVVPLCKAILETYRDLGTRGNRQ 353
225428816 262 GSHDLYEHPHINDLAYMPATK--KGRFGFNLLVGGFFSPKRCADAIPLDAWIPAD--DVLPVCQAVLEAYRDLGTRGNRQ 337
224123494 256 GSHDLYEHPHINDLAYMPAMK--DGRFGFNLLVGGFFSPKRCAEAIPLDAWVSAD--DVLPSCKAVLEAYRDLGTRGNRQ 331
255555453 255 GSHDLYEHPHINDLAYMPATK--DGRFGFNLLVGGFFSAKRCAEAIPLDAWVSAD--DVIPVCKAVLEAYRDLGFRGNRQ 330
302811448 281 GSHDLYEHPHINDLAYIPATK--DGRFGFNILVGGFFSPKRCAEALPLDAWVPGD--EVIPVCQSILETFRDLGFRGNRQ 356
302796346 281 GSHDLYEHPHINDLAYIPAIK--DGRFGFNILVGGFFSPKRCAEALPLDAWVPGD--EVIPVCQSILETFRDLGFRGNRQ 356
219119472 361 KARLMWLVEKYGVEEWKKAVTKEITSydRGVSVEDAQPAPSGKFERRELLGIHKQPQDGKVRVGVLVPSGRLSRHECREI 440
145351091 385 KCRMMWLIDEMGLETFRTEVASRMPT--GDLARGAEVDLIDRESPRRSYIGVHAQKQEGLSWVAAAVPGGRMQPEDLAEM 462
159477377 336 QTRLMWLVEAVGVDKFRQLLSEYMGG--ATFGEPVHVHH-DQPWERRNLLGVHRQRQAGLNWVGACVPAGRLHAADFEEI 412
168046727 354 KTRMMWLIDEMGVEEFRAEVERRMPS--GTIRR-AGQDLIDPSWKRRSFFGVNPQKQAGLNYVGLHVPVGRLHAPEMFEL 430
168049146 354 KTRMMWLIDEMGIEEFRAEVERRMPG--GSILR-AGKDLVDPSWTRRSFYGVNPQKQPGLNYVGLHIPVGRLHAPEMFEL 430
225428816 338 KTRMMWLIDELGIEQFRAEVVKRMPQ--QELERSSSEDLVQKQWERRDYLGVHPQKQEGFSFVGIHIPVGRVQADDMDEL 415
224123494 332 KTRMMWLIDELGIEGFRSEVVKRMPR--QELERESSEDLVQKQWERRDYFGVHPQKQEGLSYAGLHIPVGRVQADDMDEL 409
255555453 331 KTRMMWLIDEIGLEGFRSEVERRMPQ--QKLERASSEDLVQKQWERRDYFGVHPQSQEGFSYVGIHIPVGRVQADDMDEL 408
302811448 357 KCRMMWLIDELGIEGFRSEVEKRM-R--EPLARAAETDLLNPSWQRRDLFGVHRQKQDGLNFVGLHVPVGRVQAAEMIEL 433
302796346 357 KCRMMWLIDELGIEGFRSEVEKRM-R--EPLARAAETDLLNPSWQRRDLFGVHRQKQDGLNFVGLHVPVGRVQAAEMIEL 433
219119472 441 ADIADKYSDGEVRLTVEQNIIFPNVDEDKVDELLAEPAFgagKRLKTNPGFIEGNIVSCTGAQFCGLALIETKSNAEALG 520
145351091 463 ADLADKYGEGEIRLTVEQNFIIPHVPNDKIDAILQERLF---QEYTPFPGKLVSNMVACTGNQFCGFAQIETKRQALEMA 539
159477377 413 AAVAEKYGDGTVRITCEENVIFTNVPDAKLEAMKAEPLF---QRFPIFPGVLLSGMVSCTGNQFCGFGLAETKAKAVKVV 489
168046727 431 ARIADEYGNGEIRITVEQNLILPNIPTEKIDKLMQEPLL---QKYSPNPTPLLANLVACTGSQFCGQAIAETKALSLQLT 507
168049146 431 ARIADEYGNGEIRISVEQNLILPNVPTEKIEKLLKEPLL---EKYSPNPTPLLANLVACTGSQFCGQAIAETKARSLQLT 507
225428816 416 ARLADEYGSGELRLTVEQNIIIPNVENSRLEALLKEPLLr--DRFSPEPPILMKGLVACTGNQFCGQAIIETKARALKVT 493
224123494 410 ARLADIYGTGELRLTVEQNIIIPNIEDSKIEALLKEPLLk--DRFSPEPPLLMQGLVACTGKEFCGQAIIETKARAMKVT 487
255555453 409 ARLADTYGSGELRLTVEQNIIIPNIENSKIEALLQEPLLk--HKFSPEPPILMKGLVACTGNEFCGQAIIETKARAMKVT 486
302811448 434 ARLADEYGSGEIRLTVEQNIIIPNVPSSKVDSFLREPLL---ARFSPTPGILQANLVACTGSQFCGQAIIETKARAQKLT 510
302796346 434 ARLADEYGSGEIRLTVEQNIIIPNVPSSKVDSFLREPLL---ARFSPTPGILQANLVACTGSQFCGQAIIETKARAQKLT 510
219119472 521 KKLERLVTVDRPIRIHWTGCPNSCGQVQVADIGIMGGPARKEiDGKkmAVPGCKIFVGGRVGEDAHLALEpYKEGIPLDD 600
145351091 540 EHLESCLELSKDVRMIWTGCPNSCAPVQVADIGLMGAQVKNP-TGEkgMVPGVNIFIGGTVGPNGHLKEApEIAKVPCSE 618
159477377 490 EALDAQLELSRPVRIHFTGCPNSCGQAQVGDIGLMGAPAKHE--GK--AVEGYKIFLGGKIGENPALATE-FAQGVPAIE 564
168046727 508 QQLEDTMETTRPIRLHFTGCPNTCAQIQVADIGFMGTMARDE-NRK--PVEGFDIYLGGRIGSDSHLGEL-VVPGVPATK 583
168049146 508 QELEATMETTRPIRLHFTGCPNTCAQIQVADIGFMGTMARDE-NRK--PVEGFDIYLGGRIGSDSHLGEL-VVPGVPATK 583
225428816 494 EDVGRLVSVTQPVRMHWTGCPNSCGQVQVADIGFMGCMTRDE-NGN--VCEGADVFLGGRIGSDCHLGEV-YKKRVPCKD 569
224123494 488 EEVQRLVSVSKPVRMHWTGCPNTCGQVQVADIGFMGCMARDE-NGK--ICEGADVYVGGRVGSDSHLGEL-YKKSVPCKD 563
255555453 487 EEVQRLVSVTQPVRMHWTGCPNTCGQVQVADIGFMGCMTRDE-NGK--VCEGVDVFLGGRIGSDSHLGDV-YKKSVPCKN 562
302811448 511 EELERTMEVPRPVRMHWTGCPNSCGQIQVADIGFMGCMTRDA-NKK--VVEGVHIYVGGRVGADSHLGDL-VVADVPCDG 586
302796346 511 EELERTMEVPRPVRMHWTGCPNSCGQIQVADIGFMGCMTRDA-NKK--VVEGVHIYVGGRVGADSHLGDL-VVADVPCDG 586
219119472 601 ddLLPVLVDILKTEFGAKEKR 621
145351091 619 --LKPVLEQIMIERFGA---- 633
159477377 565 svLVPRLKEILISEFGAKERA 585
168046727 584 --LLPVVQELMIQHFGAKRKP 602
168049146 584 --LLPVVQDLMIQHFGAKRKT 602
225428816 570 --LVPLVAEILVNHFGGVPRE 588
224123494 564 --LVPLVVDILVKQFGAVPRE 582
255555453 563 --LVPLVVDILVNNFGAVPRE 581
302811448 587 --LLPVVQDLLIERFGARKK- 604
302796346 587 --LLPVVQDLLIERFGARKK- 604
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap