Conserved Protein Domain Family
PLN02430

?
PLN02430: PLN02430 
long-chain-fatty-acid-CoA ligase
Statistics
?
PSSM-Id: 178049
View PSSM: PLN02430
Aligned: 8 rows
Threshold Bit Score: 1353.71
Threshold Setting Gi: 115461913
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224068616   3 LKAFAAQVEEGREGKDGKPSVGPVYRNLLSKKEYPPLDRDVTTSWDIFSSSAKKYPEYKMLGWRKFVDGKVGPYVWKTYK 82 
15226536    1 MKSFAAKVEEGVKGIDGKPSVGPVYRNLLSEKGFPPIDSEITTAWDIFSKSVEKFPDNNMLGWRRIVDEKVGPYMWKTYK 80 
115461913   6 KKVFTVQVEDGKPRKDGRPAVGPVFRSALSKDGFPPLEPDMKTSWDVFRVAAGKYPDNRMLGWRPVKDGVIGPYIWKSYR 85 
79324939    1 MKSFAAKVEEGVKGIDGKPSVGPVYRNLLSEKGFPPIDSEITTAWDIFSKSVEKFPDNNMLGWRRIVDEKVGPYMWKTYK 80 
225437622   1 MKTFAVQVENGREGRDGKPSVGPVYRNFLAKSGFPPMDSNLNTAWDNLRISSEKYPGNRMLGWREFVGGKLGPYKWKTYR 80 
255548375   1 MKVFAVEVEEGREGKDGNPSVGPVYRNVLSKNEFPAPDCDMDTAWDLFSVSVKKYPENKMLGWRKFVNGKVGPYVWKTYK 80 
297824813   1 MKSFAAKAEEGVKGIDGKPSVGPVYRNLLSEKGFPPIDSEITTAWDIFSKSVEKFPDNNMLGWRRIVDEKVGPYMWKTYK 80 
297824815   1 MKCFAAKVEEGVKGEDGKPSVGPVYRNLLSEKGFPPRDSDITTTWDIFSKSVEKFPDNKMLGWRQIVDEKVGPYMWKTYK 80 
224068616  83 EVYDEVLQISSALRASGAEPGYRVGIYGSNCPQWIEAMEACNAQSLVCVPLYDTIGPRAVNFIIDHAEIDFVFVQDKKVK 162
15226536   81 EVYEEVLQIGSALRAAGAEPGSRVGIYGVNCPQWIIAMEACAAHTLICVPLYDTLGSGAVDYIVEHAEIDFVFVQDTKIK 160
115461913  86 EVYEEVLQVGSALQQLGVKPGSRIGIYGSNCPQWIVAMQACNGYSLICVPLYDTLGAGAVDFIIDHAEIDVIFVQDKKIK 165
79324939   81 EVYEEVLQIGSALRAAGAEPGSRVGIYGVNCPQWIIAMEACAAHTLICVPLYDTLGSGAVDYIVEHAEIDFVFVQDTKIK 160
225437622  81 EVYEEILHIGSALQASGAQPGSRVGIYGSNCPQWIVAMEACSAYSLICVPLYDTLGPGAVDYIIDHAEVDFVFVQDKKVK 160
255548375  81 EVYEEVLQIGSALRASGAEPGCRVGIYGSNCPQWIVAMEACSAHSLVCVPLYDTLGPNAVNFIVDHAEIDFAFVQDKKVK 160
297824813  81 EVYEEVLQIGSALRAVGAEPGCRVGIYGINCPQWIIAMEACAAHTLICVPLYDTLGSGAVDYIVEHAEIDFVFVQDTKIK 160
297824815  81 DIYEEVLLIGSALRAVGAEPGCRVGIYGANCPQWIIAMEACAAHTLICVPLYDTLGPGAVDYIVDHAEIDFVFVQNTKIR 160
224068616 163 ELLDPDCASAQRLKAIVCFTSLTEEEKDRAAQMGIKSYSWEEYLCMGKENPSEIFPPQPLSICTIMYTSGTSGDPKGVVI 242
15226536  161 GLLEPDCKCAKRLKAIVSFTNVSDELSHKASEIGVKTYSWIDFLHMGREKPEDTNPPKAFNICTIMYTSGTSGDPKGVVL 240
115461913 166 EILSANCKSAKRVKGLVAFTSGTSEEITSADQIGMKLYSWKDFLKMGKENPAQPCAPKPNDTCTIMYTSGTSGEPKGVML 245
79324939  161 GLLEPDCKCAKRLKAIVSFTNVSDELSHKASEIGVKTYSWIDFLHMGREKPEDTNPPKAFNICTIMYTSGTSGDPKGVVL 240
225437622 161 ELLNPDCRSAKRLKLMVCFTSPTEEQKDKAADIGIKPYSWDEFLHMGKENPSEVFPPQPLDICTIMYTSGTSGDPKGVVL 240
255548375 161 ELLNPDCGSASRLKTVVCFTSLTEEEKDKAEQIQIKPYSWEEFLRLGKENPSETSPPHPFSICTIMYTSGTSGDPKGVVL 240
297824813 161 GLLEPDCKCAKRLKAIVSFTNVSDELSHKASEIGVKTYSWIDFLHMGREKPEETNPPKALNICTIMYTSGTSGDPKGVVL 240
297824815 161 GLLEPDCKGAKRLKAIVSFTNVGEEQSYKALEIGVKAYSWLDFLHMGQEKPKETNPPKPSDVCTIMYTSGTSGEPKGVLL 240
224068616 243 LHETVAAFVRGIDLFMEQFEDKMTTDDVYLSFLPLAHVLDRMIEEYFFRKGASVGYYHGDLNALRDDLMELKPTCLAGVP 322
15226536  241 THQAVATFVVGMDLYMDQFEDKMTHDDVYLSFLPLAHILDRMNEEYFFRKGASVGYYHGNLNVLRDDIQELKPTYLAGVP 320
115461913 246 SHESHAIYVKGVDLFMEQFDDKMTTDDVFLSFLPLAHILDRMIEEFFFHKGASVGYYHGDLNALRDDLMELKPTLLVGVP 325
79324939  241 THQAVATFVVGMDLYMDQFEDKMTHDDVYLSFLPLAHILDRMNEEYFFRKGASVGYYHGNLNVLRDDIQELKPTYLAGVP 320
225437622 241 THENVTTIVRGVDIFMEQFEDKMTVDDVYLSFLPLAHILDRIIEEYFFHKGASVGYYHGDMNALREDLMELKPTLFAGVP 320
255548375 241 THEAVMSFLRSVDLFMEQFEDKMTVDDVYLSFLPLAHILDRMIEEYFFRKGAAVGYYHGDLNALKDDLMELKPTFLAGVP 320
297824813 241 THQAVATFVVGMDIFMDQFEDKMTHDDVYLSFLPLAHILDRLNEEYFFRKGASVGYYHGDLNVLRDDIQELKPTYLAGVP 320
297824815 241 THEAAATCVIGVDLCLDQFEDKMTHEDVYLSFLPLAHILDRANEEYFFRKGASVGYYHGDLNALHDDIQELKPTFLAGVP 320
224068616 323 RVFEKIQEGMEipiKALQELSPLRRNIFDVLYRYKLGWMNRGYRQKYASPLADLLAFRKVKAKLGGRLRLIICGGASLST 402
15226536  321 RVFERIHEGIQ---KALQELNPRRRFIFNALYKHKLAWLNRGYSHSKASPMADFIAFRKIRDKLGGRIRLLVSGGAPLSP 397
115461913 326 RVYEKIYEGIL---KALSELRPLRRLIFNALYNRKLANMKAGCTHKTASPFADMLAFRKVKARLGGRLRLLISGGAPLSN 402
79324939  321 RVFERIHEGIQ---KALQELNPRRRFIFNALYKHKLAWLNRGYSHSKASPMADFIAFRKIRDKLGGRIRLLVSGGAPLSP 397
225437622 321 RVFERVHEGIK---KAVQELNPIRRRIFGVLYKYKLSWMNSGYKHREASPLADLLAFRKVKARLGGRVRLIISGGAPLST 397
255548375 321 RVFEKIHEGIK---KALEELNPVRRRIFDALYKYKLYWMNLGYKQKYASPLADLLAFRKVKAKLGGRLRLIISGAAPLST 397
297824813 321 RVFERIHEGIQ---KALQELNPRRRLIFNALYKHKLAWMNRGYSHSKASPMADFIAFRKIRDKLGGRIRLLVSGGAPLSP 397
297824815 321 RVFERIYDGIQ---KALQELNPRRRLIFYALYKYKLAWMNRGYSHSKASPMADFIAFKKIKNQLGGRIRLLVSGGAPLSL 397
224068616 403 EVEEFLRVTSCAFVIQGYGLTESCGPATMAFPDEMCMLGTVGAVAVYNDLCLEEVPEMGYDPLGNPPCGEICLRGKTLFS 482
15226536  398 EIEEFLRVTCCCFVVQGYGLTETLGGTALGFPDEMCMLGTVGIPAVYNEIRLEEVSEMGYDPLGENPAGEICIRGQCMFS 477
115461913 403 EIEEFLRVTSCAYFIQGYGLTETLGPSTVCYPDDMSLVGTVGVAATYTELRLEEVPEMGYNPLGTPSRGEICVRGN-FFT 481
79324939  398 EIEEFLRVTCCCFVVQGYGLTETLGGTALGFPDEMCMLGTVGIPAVYNEIRLEEVSEMGYDPLGENPAGEICIRGQCMFS 477
225437622 398 EVEEFLRVTSCAFLTQGYGLTETCGLTSIGFPDEMSMIGTVGAVSVYSELRLEEVPEMGYDPFGDPPRGEICVRGKTIFA 477
255548375 398 EVEEFLRVTCCAFVVQGYGLTETCGPVTIGFPDEMCMMGAVGAVCVCNELRLEEVPEMGYNPLGNPPRGEICVRGKTLFS 477
297824813 398 EIEEFLRVTCCCFVVQGYGLTETLGGTALGFPDEMCMLGTVGIPAVYNEIRLEEVAEMGYDPLGENPAGEICIRGQCMFS 477
297824815 398 EIEEFLRVTSCCFVVQGYGLTETLGGTTLGYPDEMCMLGTVGVPAVYNEIRLEEVPEMEYDPLGENPAGEICIRGICLFS 477
224068616 483 GYYKNPELTRESMKDGWFHTGDIGEILPNGVVKIIDRKKNLIKLSQGEYIAIEYLENVYNNTPIVEDIWIYGDSCKSMLV 562
15226536  478 GYYKNPELTEEVMKDGWFHTGDIGEILPNGVLKIIDRKKNLIKLSQGEYVALEHLENIFGQNSVVQDIWVYGDSFKSMLV 557
115461913 482 GYYKNPELTNEVMADGWFHTGDIGEMNSDGILKVIDRKKNIFKLSQGEYVAVEYLEKVYVFPPTVEDVWVYGDSFRSMLV 561
79324939  478 GYYKNPELTEEVMKDGWFHTGDIGEILPNGVLKIIDRKKNLIKLSQGEYVALEHLENIFGQNSVVQDIWVYGDSFKSMLV 557
225437622 478 GYHKNPELTLESIRDGWFHTGDIGEMLPNGVLKIIDRKKNLVKLSQGEYVAVEYLEKVYGTADIVEDIWVYGNSFKSMLV 557
255548375 478 GYYKNPELTRECMKDGWFHTGDIGEIHPNGVVKIIDRKKHLIKLSQGEYIALEYLENVYSITPIVEDIWVYGDSSKPMLI 557
297824813 478 GYYKNPELTEEVIKDGWFHTGDIGEILPNGVLKIIDRKKNLIKLSQGEYVALEHLENIFGQNSVVQDIWVYGDSFKSMLV 557
297824815 478 GYYKNPELTEEVMKDGWFHTGDIGEILPNGLLKIIDRKKNLIKLSQGEYVALEHLESIYGQNPIVQDIWVYGDSFKSMLV 557
224068616 563 AVVVLHEENTKSWAYLNGHMGSFTELCSLHQLQKLVLSELKTTAERNKLKGFEHIKGVILESCPFDIEKDLVTATLKKKR 642
15226536  558 AVVVPNPETVNRWAKDLGFTKPFEELCSFPELKEHIISELKSTAEKNKLRKFEYIKAVTVETKPFDVERDLVTATLKNRR 637
115461913 562 AVVNPHEENTMKWAESNGCKGSFAEICKSEGLKEHILKELQSVAAKNKLRGFEYVKGVILDPIPFDLERDLVTATMKKKR 641
79324939  558 AVVVPNPETVNRWAKDLGFTKPFEELCSFPELKEHIISELKSTAEKNKLRKFEYIKAVTVETKPFDVERDLVTATLKNRR 637
225437622 558 AVVVPHEENTKKWADLNGHKGSLSELCSLNLLHSYVLSELKAAAELSKLRGFEHIKGVILEARLFEAEQDLVTPTLKKRR 637
255548375 558 AVVALNEENTKKWAYLNGFLDSFSALCSLDQLHEYVLSELKSTAERNKLRGFERIKGAILESRPFDMERDLVTATLKKKR 637
297824813 558 AVVVPNPETVNRWAKDLGFTKPFEELCSFPELKEHIISELKSTAEKNKLRKFEYIKAVAVETKPFDVERDLVTATLKNRR 637
297824815 558 AVIVPNPETLNRWAKDLGFTKPFEELCSLPELKEHIISELKSTAEKSKLSRFEYIKAVTVETKPFDVERDLVTATLKNRR 637
224068616 643 NKLVSHYRVEIDELYQKLAEGRA 665
15226536  638 NNLLKYYQVQIDEMYRKLASKKI 660
115461913 642 NNMLKYYKPEIEKVYQKLEEQRV 664
79324939  638 NNLLKYYQVQIDEMYRKLASKKI 660
225437622 638 DKMLKHYQAKIDELYANLGEGRH 660
255548375 638 NKLLSYYQLEIDQLYKTLGGKRG 660
297824813 638 NNLLKYYQVQIDEMYRKLASKKI 660
297824815 638 TNLLKYYQVSIDEMYRKLAAKRS 660
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap