Conserved Protein Domain Family
PLN02429

?
PLN02429: PLN02429 
triosephosphate isomerase
Statistics
?
PSSM-Id: 166070
View PSSM: PLN02429
Aligned: 3 rows
Threshold Bit Score: 572.505
Threshold Setting Gi: 297824957
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15226479    1 MAATSLTAPPSFSGLRRISPKLDAAAVSSHQSFFHRVNSSTRLVSSSSSSHRSPRGVVAMAGSGKffvggnwkcNGTKDS 80 
145329204   1 MAATSLTAPPSFSGLRRISPKLDAAAVSSHQSFFHRVNSSTRLVSSSSSSHRSPRGVVAMAGSGK---------NGTKDS 71 
297824957   1 MAATSLTAPPSFSGLRRISPKLD-AAVSSHQSFFHRVSSSTRLVSSSSSSHRSPRGVVAMAGSGKffvggnwkcNGTKDS 79 
15226479   81 IAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIDISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRH 160
145329204  72 IAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIDISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRH 151
297824957  80 IAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIDISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRH 159
15226479  161 VIGEKDEFIGKKAAYALSEGLGVIACIGEKLEEREAGKTFDVCFAQLKAFADAVPSWDNIVVAYEPVWAIGTGKVASPQQ 240
145329204 152 VIGEKDEFIGKKAAYALSEGLGVIACIGEKLEEREAGKTFDVCFAQLKAFADAVPSWDNIVVAYEPVWAIGTGKVASPQQ 231
297824957 160 VIGEKDEFIGKKAAYALSEGLGVIACIGEKLEEREAGRTFDVCFAQLKAFGDAVPSWDNIVVAYEPVWAIGTGKVASPQQ 239
15226479  241 AQEVHVAVRGWLKKNVSEEVASKTRIIYGGSVNGGNSAELAKEEDIDGFLVGGASLKGPEFATIVNSVTSKKVAA 315
145329204 232 AQEVHVAVRGWLKKNVSEEVASKTRIIYGGSVNGGNSAELAKEEDIDGFLVGGASLKGPEFATIVNSVTSKKVAA 306
297824957 240 AQEVHVAVRGWLKKNVSEEVASKTRIIYGGSVNGGNSAELAKEEDIDGFLVGGASLKGPEFATIVNSVTSKKVAA 314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap