Conserved Protein Domain Family
PLN02427

?
PLN02427: PLN02427 
UDP-apiose/xylose synthase
Statistics
?
PSSM-Id: 178047
View PSSM: PLN02427
Aligned: 15 rows
Threshold Bit Score: 795.988
Threshold Setting Gi: 168063797
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302796693   1 MAARLDLDGQVIEPLKICMIGAGGFIGSHLCEKLMWETQHSVLAIDVYSDKIQHLLEPGQ-SWSSRIEFHRINIKHDSRL 79 
115442487  12 AAARLDLDGNPIAPLTICMIGAGGFIGSHLCEKLMAETAHVVYAVDVYCDKIRHLVDPAPpHLHGRISFHRLNIKNDSRL 91 
224132100   4 SVVRVDLDGKPINPLTICMIGAGGFIGSHLCEKILNETQHKILALDVYNDKIKHLLEPDSlPWAGRIQFHRINIKHDSRL 83 
224102997   4 STVRINLDGKPINQLTILMIGAGGFIGSHLCEKILQETPHKILALDVYSDKIKHLLEPDSlEWAGRIQFHRINIKHDSRL 83 
225464984   1 -MARLDLDGKEIAPLTICLIGGAGFIGSHLCELLMTHTHHSAIVIDVSSDKITRLLEKSC-SWSNRIEFHKINIKNDSRL 78 
225465764   3 SAARLDLDGNAIKPMTICMIGAGGFIGSHLCEKLMAETMHKVLAVDVYNDKIRHLLEPAAhPWSDRIQFHRINIKHDSRL 82 
225436371   3 SAARLDLDGNAIKPMTICMIGAGGFIGSHLCEKLMAETMHKVLAVDVYSDKIKHLLEPSThPWSDRIQFHRINIKHDSRL 82 
242060051  11 AAARLDLDGNPIAPLTICMIGAGGFIGSHLCEKLMAETRHVVLAVDVYCDKIRHLVDPAPpHLAGRISFHRLNIKNDSRL 90 
255573008   1 MANRVDLDGRPIKEMTICMIGAGGFIGSHLCEKILNETPHKILALDVYNDKIKHLLEPDSlPWAGRIQFHRINIKHDSRL 80 
297849130   4 GAGRLDLDGKPIKPITICMIGAGGFIGSHLCEKLMTETPHKVLALDVYNDKIKHLLEPDTvQWAGRIQFHRINIKHDSRL 83 
302796693  80 EGLIKLADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVRYCSDNNKRLIHFSTCEVYGKTIGSFLPEDSSLRKacil 159
115442487  92 EGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPTDHPLRK---- 167
224132100  84 EGLIKMSDLTINLAAICTPADYNTRPLDTIYSNFIDALPVAKYCSENGKRLIHFSTCEVYGKTIGSFLPKDSPLRQ---- 159
224102997  84 EGLIKMSDLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENGKRLIHFSTCEVYGKTIGSFLPKDSPLRQ---- 159
225464984  79 ETLIKSSDLTINLAAICTPADYNTRPLDTIYSNFLDAIPVVKYCTESNKRLIHFSTCEVYGKTIGSFLPADHSLRQ---- 154
225465764  83 EGLIKMADLTVNLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQ---- 158
225436371  83 EGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLWQ---- 158
242060051  91 EGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENSKRLIHFSTCEVYGKTIGSFLPKDHPLRK---- 166
255573008  81 EGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHFSTXXSY-------------FSW---- 143
297849130  84 EGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDHPLRQ---- 159
302796693 160 fflDPSYYVLKEDESPCIFGPIEKQRWSYACAKQLIERVIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRV 239
115442487 168 ---EPEFYVLKEDESPCIFGPIVKQRWSYACAKQLIERLIFAEGAENGLEFTIVRPFNWIGPRMDFIPGVDGPSEGVPRV 244
224132100 160 ---DPAYYVLKEDASPCIFGSIEKQRWSYACAKQLIERLVYAEGAENGLEFTIVRPFNWIGPRMDFIPGVDGPSEGVPRV 236
224102997 160 ---DPAYYVLKEDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRV 236
225464984 155 ---DPDFYILKEDVSPCIFGPVEKQRWSYACAKQMIERLIYAEGAEHGLKFTIVRPFNWIGPRMDFIPGIDGPTEGVPRV 231
225465764 159 ---DPAYYLLKEDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRV 235
225436371 159 ---DPTYYVLKEDASPCIFGPIEKQRWSYACAKQLIERLIYAEGAENDLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRV 235
242060051 167 ---EPEFYVLKEDESPCIFGPIVKQRWSYACAKQLIERLIFAEGAENGLEFTIVRPFNWIGPRMDFIPGVDGPSEGVPRV 243
255573008 144 ---DPAYYILKEDESPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRV 220
297849130 160 ---DPEFYVLKEDISPCIFGSIEKQRWSYACAKQLIERLVYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRV 236
302796693 240 LACFSTNLLKSEPLKLVDGGQSQRTFVYIKDAIDAVMRMVENPQRANGYVFNVGNPDNEVTVRELALMMTEasVYTKVSG 319
115442487 245 LACFSNNLLRREPLKLVDGGQSQRTFVYIKDAIEAVHLMIENPARANGQIFNVGNPNNEVTVRQLAEMMTE--VYANVSG 322
224132100 237 LACFSNALLRREPLKLVDGGESQRTFVYIKDAIEAVLLMIENPSRANGHIFNVGNPNNEVTVRQLAEMMTA--VYANVSG 314
224102997 237 LACFSNALLRREQLKLVDGGESQRTFVYIKDAIEAVLLMIENPDRANGHIFNVGNPNNEVTVRQLAEMMTA--VYANVSG 314
225464984 232 LACFSNNLLRGEPLKLVDGGKSQRTFCYIKDAIEAVLLMIENPERANGQIFNVGNPNNEVTMRQLAQLMIE--VYGKISV 309
225465764 236 LACFSNNLLRREPLKLVDGGQSQRTFVYIKDAIEAVLLMIDNPGRANGHIFNVGNPNNEATVKQLAEMMTE--VYAKVSG 313
225436371 236 LACFSNNLLRHEPLKLVDGGQSQRTFVYIKDAIEAVLLMIDNPARANGHIFNVGNPNNEVTVRQLAEMMTE--VYAKVSG 313
242060051 244 LACFSNNLLRREPLKLVDGGQSQRTFVYIKDAIEAVVLMIENPARANGHIFNVGNPDNEVTVRELAQMMTE--VYANVSG 321
255573008 221 LACFSNALLRGEPLKLVDGGQSQRTFVYIKDAIEAVLLMIENPARANGHIFNVGNPHNEVTVKQLAEMMTE--VYSKVSG 298
297849130 237 LACFSNNLLRREPLKLVDGGESQRTFIYIKDAIEAVLLMIENPERANGHIFNVGNPNNEVTVRQLAEMMTE--VYAKVSG 314
302796693 320 RPQLDEPTIDVSSKEFYGEGYDDSDKRIPDMTIIKKQLEWEPKTSLFDLLESTLTYQHKTYARAMQQLLSKSLPT 394
115442487 323 EPPLDEPMIDVSSKQFYGEGYDDSDKRIPDMTIINKQLGWNPKTPLKDLLETTLTYQHKTYKEAIKRQMSQASAS 397
224132100 315 EPALEEPTVDVSSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSLWDLLDSTLTYQHKTYAEAIKKVMSQPTTS 389
224102997 315 EPALEEPTVDVSSKEFYGEGYDDSDKRIPDMTIINKQLGWNPKTSVWDLLDSTLTYQHKTYAEAVKKVISKPTTS 389
225464984 310 GSS-DLTTVDVSSKDFYGVGYDDSDKRIPDMTIINRQLGWNPKTPLQDLLEVTLTYQHQTYSQSIKKALSNPTY- 382
225465764 314 EPSLEVPTVDVSSKEFYGEGYDDSDKRIPDMTIINKQLGWNPKTSLWDLLESTLTYQHRTYAEAIKQAIAKPVAS 388
225436371 314 EPSLEVPTVDVSSKEFYGEGYDDSDKRIPDMTIINKQLGWNPKTSLWDLLESTLTYQHRTYAEAIKQAIAKPVAS 388
242060051 322 EAPLDEPMIDVSSSQFYGEGYDDSDKRIPDMTIINKQLGWNPKTPLKDLLETTLTYQHKTYKEAVKRQMSQASST 396
255573008 299 EPVLEVPTVDISSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSLWDLLESTLTYQHRTYAEAIKKVLAKPTSS 373
297849130 315 ETAIESPTIDVSSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSLWDLLESTLTYQHTTYAEAIKKATSKPVAS 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap