Conserved Protein Domain Family
PLN02423

?
PLN02423: PLN02423 
phosphomannomutase
Statistics
?
PSSM-Id: 178043
View PSSM: PLN02423
Aligned: 18 rows
Threshold Bit Score: 449.938
Threshold Setting Gi: 255071257
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219123104   3 ATPVKPRILALFDVDGTLTIPRGEITPDMMAFMKDLSKKVTVGIVGGSDLPKQEEQLGTGIVDVFPWNFSQNGLVAYNKG 82 
15225896    1 MAAKIPGVIALFDVDGTLTAPRKEATPELLDFIRELRKVVTIGVVGGSDLSKISEQLGKTVTNDYDYCFSENGLVAHKDG 80 
145341372   1 ---MSPRVLALFDVDGTLTVPRKEADDVMKRFMEDLRSRVTVGIVGGSDLVKISEQLGEGVEREYAYLFSENGLVAYKDG 77 
168037753   1 -MGRKEGVIALFDVDGTLTPPRKEVSADMLQFLQDLRQVVTIGVVGGSDLVKISEQLGKTAVTDYDYVFSENGLVAHKAG 79 
225454105   1 MAARKAGLIALFDVDGTLTAPRKVATPQMLEFMRKLRKVITVGVVGGSDLVKISEQLGSSVIDDYDYVFSENGLVAHKDG 80 
255071257   3 KRQRNSRTLALFDVDGTLTAPRKRADANMLKFLKDLGEKISVGIVGGSDLIKIKEQLGEDAHKDYDFLFAENGLMAFKEG 82 
297824635   1 MAAIKPGVIALFDVDGTLTAPRKEATPELLDFIRELRKVVTIGVVGGSDLSKISEQLGKTVTNDYDYCFSENGLVAHKDG 80 
302767322   1 ----MAGVIALFDVDGTLTPPRKVASVEMLDFLQELRKVITVGVVGGSDLSKISEQLGKNTINDYDYVFSENGLVAHKGG 76 
302755006   1 ----MAGVIALFDVDGTLTPPRKVASVEMLDFLQELRKVITVGVVGGSDLSKISEQLGKNTINDYDYVFSENGLVAHKGG 76 
302828828   1 --MAEKKVIAMFDVDGTLTAPRKTATKEMLEFMQELRKRVKVGIVGGSDLHKIAEQLGDGLLTSYDYVFAENGLVAYKDG 78 
219123104  83 QLLEVQTIAKFLGEDNVKRIVNWVLKYLVDIDIPVKRGTFFEFRSGMFNISPIGRNCSREERNEYERFDLENNVRKKMVE 162
15225896   81 KSIGIQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVA 160
145341372  78 ALLAKQSLKAFLGEDKLKRFINFVLHYVADLDVPVKRGTFIEFRAGMLNVSPIGRNCSQEERDEFERFDEKAGVRKAMVE 157
168037753  80 KLIGSQSLKSHLGEAKLKEFINFVLHYIADLDIPIKRGTFVEFRMGMLNVSPIGRNCSQEERDEFERYDKIHNVRKQFVD 159
225454105  81 KLIGTQSLKTFLGEEKLKEIINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKIHNIRPKMVS 160
255071257  83 SLLKATCFKEYLGEEKLKKLINFILIYIANLDIPIKRGTFVEFRNGMLNVSPIGRNCSQSERDEFERYDNISRVREKMVK 162
297824635  81 KSIGVQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVA 160
302767322  77 SQIGSQSLKSFLGDDQLKEFINFVLHYIADLDIPIKRGTFIEFRTGMLNVSPIGRNCSQEERDAFEQYDKIHNIRRDMVN 156
302755006  77 SQIGSQSLKSFLGEDQLKEFINFVLHYIADLDIPIKRGTFIEFRTGMLNVSPIGRNCSQEERDAFEQYDKIHNIRRDMVN 156
302828828  79 QQVAVQSLKTFLGEDKLKELINFCLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQQERDEFEKFDETAGVRKAFVA 158
219123104 163 AMAKEFADLGLTYSIGGQISFDCFPKGWDKTYCLKFLDasEFDEIHFFGDKTFEGGNDFEIFSHERTIGHTVTSPDDTKN 242
15225896  161 ELRERFAHLNLTFSIGGQISFDVFPKGWDKTYCLQYLE--DFSEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTVA 238
145341372 158 TLRKEFADYGLTYSIGGQISFDVFPQGWDKTYCLQFVEn-DFDVIHFFGDKTYPGGNDHEIFESPKTIGHTVTSPEDTRK 236
168037753 160 ILKEKFADYSLTFSIGGQISFDVFPKGWDKTFCLQFVEn-EFSEIHFFGDKTYQGGNDHEIFESEKTIGHTVTSPEDTIR 238
225454105 161 VLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLD--DFPEIHFFGDKTYEAGNDHEIYESERTVGHTVTSPDDTVE 238
255071257 163 VLQTQFEEYNLTYSIGGQISFDVFPKGWDKTFCLQFVEk-DYDEIHFFGDKTHRGGNDYEIYNSQRTIGHAVTSPEDTRE 241
297824635 161 ALRERFAHLNLTFSIGGQISFDVFPKGWDKTYCLQYLE--DFNEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTMA 238
302767322 157 VLKENFSHLPLTYSIGGQISFDVFPRGWDKTYCLQFLD--DFKEIHFFGDKTFKGGNDHEIFESERTIGHTVTSPGDTRE 234
302755006 157 VLKEKFSHLPLTYSIGGQISFDVFPRGWDKTYCLQFLD--DFKEIHFFGDKTFKGGNDHEIFESERTIGHTVTSPGDTRE 234
302828828 159 TLREKFAHLNLTYSVGGQISFDVFPQGWDKTYCLQFLQ--DFDEIHFFGDKTYPGGNDFEIFTSDRTVGHTVTSPDDTRK 236
219123104 243 QCTKLFM 249
15225896  239 KCKALFM 245
145341372 237 QVTEHIL 243
168037753 239 QCSELFL 245
225454105 239 QCTALFL 245
255071257 242 Q------ 242
297824635 239 KCKALFM 245
302767322 235 QCTRLFL 241
302755006 235 QCTRLFL 241
302828828 237 QRQQHGL 243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap