Conserved Protein Domain Family
PLN02420

?
PLN02420: PLN02420 
endoglucanase
Statistics
?
PSSM-Id: 178040
View PSSM: PLN02420
Aligned: 5 rows
Threshold Bit Score: 1100.85
Threshold Setting Gi: 255568709
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255568709   1 MEKKEEKNNnnckpqkpktlfPRQCPLLVLtmFTIFNTAHSL--------SFDYADALRKSLLYFEAQRSGRLPYNQRVT 72 
15225764    1 MTVMNHRHK------------QCHFLLLLL--ITVFSAALDGvssetdvgGFDYGEALSKSLLYFEAQRSGRLPYNQRVT 66 
224131672   1 -MEKKQQHQcygaapkptfrfAKQWAVLLIsiFPILNTGLA----------VDYGDALKKSLLYFESQRSGRLPYNQRVT 69 
297823089   1 ---MDHRHK------------PCHFLLLLLllITVFSAVLADvssetdvgRFDYGEALSKSLLYFEAQRSGRLPYNQRVT 65 
297789870   1 MTVMDHRHK------------PCHFLLLLLllITVFSAVLAGvssetdvgRFDYGEALSKSLLYFEAQRSGRLPYNQRVT 68 
255568709  73 WRDHSGLTDGLEQGVDLVGGYYDAGDHVKFGLPMAFTITMLSWGVIEFRDQIARAGELEHALEAIKWGTDYFMKAHTSPN 152
15225764   67 WRDHSGLTDGLEQGVDLVGGYHDAGDHVKFGLPMAFTVTMLSWSVIEYGDSLASTGELSHALEAIKWGTDYFIKAHTSPN 146
224131672  70 WRHHSGLTDGLEQGVDLVGGYYDAGDHVKFGLPMAFTVTMLSWTVIEFQHQIAVAGELEHALEAIKWGTDYFIKAHTSPN 149
297823089  66 WRDHSGLTDGLEQGVDLVGGYHDAGDHVKFGLPMAFTVTMLSWSVIEYGDTLASTGELSHALEAIKWGTDYFIKAHTSPN 145
297789870  69 WRDHSGLTDGLEQGVDLVGGYHDAGDHVKFGLPMAFTVTMLSWSVIEYGDSLASTGELSHALEAIKWGTDYFIKAHTSPN 148
255568709 153 VLWAEVGDGDTDHYCWQRPEDMTTSRQAYRIDENNPGSDLAGEAAAAMAAASIVFRTTNPHYAHLLLHHAQQLFEFGDKH 232
15225764  147 VLWAEVGDGDTDHYCWQRPEDMTTSRRAFKIDENNPGSDIAGETAAAMAAASIVFRSTNPHYSHLLLHHAQQLFEFGDKY 226
224131672 150 VLWAEVGDGDTDHYCWQRPEDMTTSRQAYRIDENNPGSDLAGETAAAMAAASIVFKKTNPHYSHLLLHHAQQLFEFGDKY 229
297823089 146 VLWAEVGDGDTDHYCWQRPEDMTTSRRAFKIDENNPGSDIAGETAAAMAAASIVFRSTNPHYSHLLLHHAQQLFGFGDKY 225
297789870 149 VLWAEVGDGDTDHYCWQRPEDMTTSRRAFKIDENNPGSDIAGETTAAMAAASIVFRSTNPHYSHLLLHHAQQLFGFGDKY 228
255568709 233 RGKYDASVNVVKSYYASVSGYMDELLWGSMWLYKATDNEEYLNYVITKAHSFGGIGWAITEFSWDVKYAGLQIMVSKLLT 312
15225764  227 RGKYDESLKVVKSYYASVSGYMDELLWGATWLYRATDNEHYMSYVVDMAHQLGGLSWAMSEFSWDVKFAGVQLLASMLLK 306
224131672 230 RGKYDENMGVVKSYYASVSGYKDELLWGALWLYKATDNEKYLEYVINNAHCFGGTGWAMEEFSWDVKYAGLQIMAAKLLV 309
297823089 226 RGKYDESLKVVKSYYASVSGYMDELLWGATWLYRATDNEHYMSYVVDMAHQLGGLSWAMSEFSWDVKYAGVQLLASMLLK 305
297789870 229 RGKYDESLKVVKSYYASVSGYMDELLWGATWLYRATDNEHYMSYVVDMAHQLGGLSWAMSEFSWDVKYAGVQLLASMLLK 308
255568709 313 DEKHKEHSLIVEQYRAKAEYYICSCLNKNNGSNNVGRTPAGLLHIRQWNNMQYVSTAAFLLTIYSGFLRSLNRKLECHGG 392
15225764  307 EEKHKQHSKVLQQYKSKADHYLCSILNKNINGTNVQRTPAGLLYVRQWNNMQYVSTASFLLTVYSDHLRKSNTDLECHEG 386
224131672 310 EEKHREHGDTLEQYRSKAEHYLCSCLNKN-NGTNVNRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNSNQKLKCHGG 388
297823089 306 EEKHKQHSKVLQQYKSKADHYLCSILNKNINGTNVQRTPAGLLYVRQWNNMQYVSTASFLLTVYSDHLRKSNTDLECHEG 385
297789870 309 EEKHKQHSKVLQQYKSKADHYLCSILNKNINGTNVQRTPAGLLYVRQWNNMQYVSTASFLLTVYSDHLRKSNTDLECHEG 388
255568709 393 LVDHEEMLTFTKSQVDYILGSNPMNMSYLVGYGPNYPTRVHHRGASIVSYRENKGFIGCTQGYDNWYSREEQNPNVLVGA 472
15225764  387 TVTPDEMLGFAKSQIDYILGSNPMETSYLVGYGPKYPIRVHHRGASIASFKEHKGFIGCTQGYDNWYGRSEPNPSVLVGA 466
224131672 389 SVDHEEILGFAKSQVDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQGYDNWYGREEPNPNVLVGA 468
297823089 386 TVTPDEMLGFAKSQIDYILGSNPMETSYLVGYGPKYPTRVHHRGASIASFKEHKGFIGCTQGYDNWYGRSEPNPSVLVGA 465
297789870 389 TVTPDEMLGFAKSQIDYILGSNPMETSYLVGYGPKYPTRVHHRGASIASFKEHKGFIGCTQGYDNWYGRSEPNPSVLVGA 468
255568709 473 LVGGPDCQDNFMDKRGNYMQTEACTYNTAPLVGVFAKFLEMEDQK---EKGQPLVASY 527
15225764  467 LVGGPDHQDDFDDRRGNYVQTEACTYNTAPLVGVFARLIELEEQKl-eEEDVSLVATY 523
224131672 469 LVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKLLQMEGQKshdNHNQPLVASY 526
297823089 466 LVGGPDEQDEFDDRRDNYVQTEACTYNTAPLVGVFARLIELEEQKl-eEEDVSLVATY 522
297789870 469 LVGGPDEHDEFDDRRDNYVQTEACTYNTAPLVGVFARLIELEEQKl-eEEDVSLVATY 525
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap