Conserved Protein Domain Family
PLN02417

?
PLN02417: PLN02417 
dihydrodipicolinate synthase
Statistics
?
PSSM-Id: 178038
View PSSM: PLN02417
Aligned: 23 rows
Threshold Bit Score: 422.514
Threshold Setting Gi: 219116218
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223995213   1 MRQGSYVALVTPMTPTGTIDLPALRSLLRFHLEAGTDGLCILGTTGEAAVMTMTERKSVLDVAVEEVKGKMPILVGTGTI 80 
168026205  10 KNLRLITAIKTPYLPDGRFDLEAFDSLVDLQIANGAEGLIVGGTTGEGQLMTWDEHIMLIGHTVKYFGSEIKVIGNTGSN 89 
145346467  68 RAKRLITAIKTPYLASGKVDLFAYDALVEQQIAGGVEGLIVGGTTGEGQLMSWDEHIMLIAHTAQRYGGKVKVIGNTGSN 147
159483379  45 KKLRLITAIKTPYLANGKFDLPAYDALVSHQIENGVEGLIVGGTTGEGHLMSWDEHVMLIAHTVNAFGDKTAVIGNTGSN 124
168007999  10 KNLRLITAVKTPYLPDGRFDLEAYDTIVDLQIANGAEGLIVGGTTGEGQLMTWDEHIMLIAHTVHIFGDAIKVIGNTGSN 89 
223993409   3 MKQGSSCAIITPMTNEGKLDIPSLRKLLKFHLASETDNLCILGTTGEASVLNMEERAQVLTTAVEEVKGKIPILAGTGTI 82 
242093822  82 TSLRLITAVKTPYLPDGRFDLEAYDSLINMQIEGGAEGVIVGGTTGEGHLMSWDEHIMLIGHTVNCFGSRIKVIGNTGSN 161
302831141  43 KKIRLVTAVKTPYLPNGKFDLPAYDALVSRQIANGVEGLIVGGTTGEGHLMSWDEHVMLIAHTVNAFGGQLAVIGNTGSN 122
302802285  67 KKLRLISAIKTPYLPDGRFDLEAYDSLVRTQVDHGVEGLIVGGTTGEGHLMNWDEHIMLIARTVNCFGDKIKVIGNTGSN 146
302800325  67 KKLRLISAIKTPYLPDGRFDLEAYDSLVRTQVDHGVEGLIVGGTTGEGHLMNWDEHIMLIAHTVNCFGDKIKVIGNTGSN 146
223995213  81 DPEHVKEQTMQAIDCGCDASLLVTPYYVKPPQRGLIKHFETMADLGlPVCIYNVPGRTGVDFTPESIGKVAGHPNIVAVK 160
168026205  90 STREAVHATEQGFAVGMHGALHINPYYGKTSNEGLIRHFSSVLDMG-PTIIYNVPGRTGQDISPSVINEISVNSNFVGIK 168
145346467 148 STREAVHATQQGFAVGMDASLQINPYYGKTSRAGLLEHFEAVMDLG-PAIVYNVPARTSQDIVPDIMFELAKHANFAGVK 226
159483379 125 STREALHATEQGFAVGMHASLQINPYYGKTSKAGLLNHFNAVLNEG-PAVVYNVPGRTGQDIPDDVVMEICQHSNFLGMK 203
168007999  90 STREAIHATEQGFGVGMHGALHINPYYGKTSNEGLIKHFESVLEMG-PTIIYNVPGRTGQDIPPSVIERISDKRNFVGIK 168
223993409  83 KPEAVREMTLQAIELGCDASLVVTPYYVKPPQRGLIKHFTDMADIGlPVVMYNIPGRSQVDLSVESTVICAQHPNIIGLK 162
242093822 162 STREAVHATEQGFAVGMHAALHINPYYGKTSTEGMISHFEAVLPMG-PTIIYNVPSRSAQDISPEVIVAISGYTNMAGVK 240
302831141 123 STREALHATEQGFAVGMHASLQINPYYGKTSKAGLLNHFNAVLNEG-PAIVYNVPGRTGQDIPDDVVLEISKHSNFLGMK 201
302802285 147 STREAIHATEQGFAAGMHAALHINPYYGKTSMDGLLLHFKSVLAMG-PTVIYNVPGRTGQDIPPSVIEKIASSPNFLGVK 225
302800325 147 STREAIHATEQGFAAGMHAALHINPYYGKTSMDGLLLHFKSVLAMG-PTVIYNVPGRTGQDIPPSVIEKIASSPNFLGVK 225
223995213 161 EATGDvSRVGKihdamkdngVQTDKLLLFSGDDGSTDEFVLA-GGDGCISVTANVAPSQMHNLMMAAlKKdtdavKKIND 239
168026205 169 ECVGN-ERVGA---------YVEKGFSVWSGNDDQFHDARWNyGAQGVISVVSNLIPRLAHKLLFDG-KD-----VDLNK 232
145346467 227 ECEGN-ARIKQ---------YTDNGVTCWTGNDDECHDARYDaGAVGVISVTSNLVPELMREMLFDG-PN-----PELRD 290
159483379 204 ECTGN-SRIKN---------YTSKGVNCWSGNDDESHDARHSnGAVGVISVTSNVIPGLMHKLMHGS-PD-----PQLNA 267
168007999 169 ECVGN-DRVGA---------YVKKGLTIWSGNDDQFHDARWDyGAQGVISVVSNLIPQLAHKLLFEG-KD-----SELNE 232
223993409 163 DATGDlDRVQQirq----slAAEDDLLLYSGEDGTSSEFVMR-GGDGCISVTANVAPKAIHDLMMASlAGnaelaKNINK 237
242093822 241 ECVGH-ERIQQ---------YADKGITIWSGNDDECHDSRWKyGATGVISVTSNLVPGLMHSLMYKG-EN-----AMLNE 304
302831141 202 ECTGN-ARIKN---------YVTRGVNCWSGNDDESHDARHSaGAVGVISVTSNVIPGLMNQLMHGSqPD-----TALNS 266
302802285 226 ECMGN-ERVKH---------YTEQGIAVWSGNDDQCHDSRWDfGARGVISVVSNLVPKLMHELMFSG-KN-----QELNE 289
302800325 226 ECMGN-ERVKH---------YTEQGIAVWSGNDDQCHDSRWDfGARGVISVVSNLVPKLMHELMFSG-KN-----QERNE 289
223995213 240 PLRSLHSDLFCEANPIPVKWAVKRIGQIDCAYlRPPLDELCPDLQGKVEAAIKEGGLI 297
168026205 233 KLLPLIDWLFVEPNPIGLNTALAQLGVIRPVF-RLPYVPLSIEKRWEFVQMVHDIGRE 289
145346467 291 RLLPLMNWLFAEPNPTGINTACAMLGVAQPVF-RLPYVPYAAALRAQGAEHLRAVGLD 347
159483379 268 DLKELMAWMFCEPNPISLNTALAMCGLARPVF-RLPYVPLSRAQREKGAVLLNKV-QE 323
168007999 233 KLLPLIDWLFVEPNPIGLNTALCQLGLIRPVF-RLPYVPLGKEKRREFVQMVNQIGRH 289
223993409 238 PMLDLHKKLFVESNPIPVKYAAWRMGLISTPYcRPPLSNLDAKYYNDVETAMEAAGLF 295
242093822 305 KLLPLMKWLFCQPNPIAVNTALAQLGVARPVF-RLPYVPLPLEKRIEFVRIVEAIGRE 361
302831141 267 SLKELFAWLFCEPNPIALNTALAMCGLVKPVF-RLPYVPLDRQQREKGAALLMAV-QE 322
302802285 290 KLMPLINWLFVEPNPIGLNTALSQLGLIRPVF-RLPYAPLNVEKRQEFVKIVEGIGRD 346
302800325 290 KLMPLINWLFVEPNPIGLNTALSQLGLIRPVF-RLPYAPLNVEKRQEFVKIVEGIGRE 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap