Conserved Protein Domain Family
PLN02416

?
PLN02416: PLN02416 
probable pectinesterase/pectinesterase inhibitor
Statistics
?
PSSM-Id: 178037
View PSSM: PLN02416
Aligned: 5 rows
Threshold Bit Score: 1005.61
Threshold Setting Gi: 224069284
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225308    1 MALSSFNLssLLFLlfFTPSVFS---------YSYQPSLNPHETSATSFCKNTPYPDACFTSLKLSISINISPNILSFLL 71 
224069284   1 MAFSILKL--LLLL--ISSVFFTstw---alnTSSTTSLDAHLSTIRTFCNSRPYPDACFNSLKLSISINISPNIINLLL 73 
225444579   1 MTSSSLRW--LLFL--CPIFFFSgasalnysnASYTS-----LKSVTSFCKSTPYPDVCFQSLKVHVSININPNIITFLL 71 
255550283   1 MAFSLLNL--LLLLffFSPIFFSsawaanissSSSANSLDTHLSSLRNFCSGRPYPDACFDSLKLSISINISPNILNYIL 78 
297822157   1 MALSTLNFs-FLFFllFTPLVVS-------------TSLKPNQTSLTSFCMNTPYPNACFDSLKLSISINISPNILSFLL 66 
15225308   72 QTLQTALSEAGKLTDLLSGAGvSNNLVEGQRGSLQDCKDLHHITSSFLKRSISKIQDGvnDSRKLADARAYLSAALTNKI 151
224069284  74 QTLQTAISEAGKLTNLFSIAG-GSNIIERQRGTIQDCLELHQITVSSLQRSVSRVRAG--DSRKLVDARAYLSAAVTNKN 150
225444579  72 HSLQTAISEAGKVSTLLSTAGqHSDVIEKQRGTIQDCRELHQITVSSLQRSVSRVRSG--DSQKLKDARAFLSASLTNKV 149
255550283  79 QTLQTAISEAGKLTNLFSSAGsSSNIIQKQRGTIQDCKELHEITLSSLKRSVSRIQAG--DSQKLADARAYLSAALTNKN 156
297822157  67 QTLQTALSEAGKLTDLLSGAGiSNNLVEGQRGSLQDCKDLHQITSSFLKRSISKIQDGvnDSRKLADARAYLSAALTNKI 146
15225308  152 TCLEGLESASGPLKPKLVTSFTTTYKHISNSLSALPKQRRTTNpktggNTKNRRLLGlFPDWVYKKDHRFLEdsSDGyDE 231
224069284 151 TCLEGLDSASGPLKPALLNSLTSTYQHVTNSLSMLPKSKHSKQ-----GYKNRRLLG-FPKWMSKKDRRILQ--SDE-DE 221
225444579 150 TCLEGLDSAAGPSKPTLVNSIVAAYKHVSNCLSVLS-KSTPQK-----GPINRRLMG-APAWAS---RRILQ--SSG-DE 216
255550283 157 TCLEGLDSASGPLKPVLVNSVISTYKHVSNSISMIP-SPNSEK-----GQKNRRLLG-FPKWLSKKDRRILQ--SDDgDE 227
297822157 147 TCLEGLDTASGPLKPKLVTSFMETYKHVSNSLSALPKQRRATNlktdgKTKNRRLFGlLPDWVSKKDHRFLEdsSDGyDE 226
15225308  232 YDPSESLVVAADGTGNFSTINEAISFAPNMSNDRVLIYVKEGVYDENIDIPIYKTNIVLIGDGSDVTFITGNRSVGDGWT 311
224069284 222 YDPSEELIVAADGTGNFSTITDAINFAPNNSYDRIIIRVREGVYAENVEIPIYKTNIVLLGDGTDVTFITGNRSVVDGWT 301
225444579 217 YDPSEVLTVAADGTGNFTTVTDAINFAPNNSNDRIIIYVREGVYEENVDIPSHKTNIVFLGDGSDVTFITGSRSVVDGWT 296
255550283 228 YDPSEVLVVAADGTGSFTTITDAINFAPKNSFDRIIISVKEGVYEENVEIPSYKTNIVLIGDGSDVTFITGNRSVDDGWT 307
297822157 227 YDPSEIIVVAADGTGNFSTINEAISFAPDMSNDRVLIYVREGVYDENIEIPIYKTNIVLIGDGSDVTFITGNRSVGDGWT 306
15225308  312 TFRSATLAVSGEGFLARDIMITNTAGPEKHQAVALRVNADFVALYRCVIDGYQDTLYTHSFRQFYRECDIYGTIDYIFGN 391
224069284 302 TFRSATLAVSGDGFLALDITIDNTAGPEKHQAVALRVSADLVALYRCSINGYQDTLYVHSFRQFYRECDISGTIDYLFGN 381
225444579 297 TFRSATV---GNGFLARDITFENRAGPEKHQAVALRINADLAAVYKCTILGYQDTLYVHSFRQFYRECDIFGTIDFIFGN 373
255550283 308 TFRSATLAVSGEGFLARDITIENTAGAQKHQAVALRINADLAAMYRCTINGYQDTLYVHSFRQFYRECDIYGTIDYIFGN 387
297822157 307 TFRSATLAVSGEGFLARDMMITNTAGPEKHQAVALRVNADFVALYRCVIDGYQDTLYTHSFRQFYRECDIYGTIDYIFGN 386
15225308  392 AAVVFQGCNIVSKLPMPGQFTVITAQSRDTQDEDTGISMQNCSILASEDLFNSSNKVKSYLGRPWREFSRTVVMESYIDE 471
224069284 382 AAVVFQACNIISRKPLPNQFTVITAQSKETPDEYTGISIQNCSILATEDLYSNSNTVKSYLGRPWKVYSTTVVLESYIDD 461
225444579 374 AAVVFQACNIVARMPMAGQFTVVTAQSRDTSDEDTGISIQNCSISATDDLYSNRGSVKSYLGRPWKVYARTVYLESYIDD 453
255550283 388 AAVVFQACNIVSKMPLPGQFTVITAQSREIPEEDTGISIQNCSILATEDLYSNASSVKSYLGRPWRTYSRTVILESYIDD 467
297822157 387 AAVVFQGCNIVSKLPMPGQFTVVTAQSRDSPDEDTGISMQNCSILASDDLFNSSNRVKSYLGRPWREFSRTVLMESYIDE 466
15225308  472 FIDGSGWSKWNG--GEALDTLYYGEYNNNGPGSETVKRVNWPGFHIMGYEDAFNFTATEFITGDGWLGSTSFPYDNGI 547
224069284 462 FINPEGWSKWSNddDQGLDTLYYGEYENYGPGSGTENRVTWAGYHVMDDIDAYNFTVSYFITGDEWLDSTSIPYYDGI 539
225444579 454 FIDPSGWTEWNG--NEGLDTLYYGEYDNNGPGSGTENRVTWQGYHVMEDNDAYNFTVSEFITGDEWLDSTYFPYDDGI 529
255550283 468 FINPTGWIEWPG--NQGLDTLYYGEYDNYGPGSATDNRVTWQGYHVMDYYDAFNFTVSYFITGDEWLDSTSFPYDDSI 543
297822157 467 FIDGSGWSKWNG--REELDTLYYGEYNNNGPGSETGKRVNWPGFHIMGYEDAFNFTTTEFITGDGWLGSTSFPYDNGI 542
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap