Conserved Protein Domain Family
PLN02415

?
PLN02415: PLN02415 
uricase
Statistics
?
PSSM-Id: 178036
View PSSM: PLN02415
Aligned: 11 rows
Threshold Bit Score: 499.702
Threshold Setting Gi: 255088958
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115441235   1 MADRLELQGRHGKSRVRVSRVWRrpAAAGGHVIVEWNVAVSVVSDCLPSYTSDDNSAIVATDSIKNTVYVKAKECTEIVS 80 
15225267    4 EADGIRLDQRHGKARVRVGRVWRh-AHDGSHHFVEWNVSISLLSHCLSSYRLDDNSDIVATDTIKNTVYVKAKECGDRLS 82 
168048397   1 -MEGFALQHQHGKAKVRVGRLWRg-ATSQEHRFVEWNVSVSITSFVLPAFTDGDNSKIVATDSIKNTIYYLAKQCTEELS 78 
225464393   5 KIDGFTLEQRHGKARVRLGRVWR--SQSGRHIFVEWTVSISLLSNCLAAYVRDDNSDIVATDSMKNTVYAKAKECAQQLS 82 
224110112   4 ELDGFNFEQRHGKARVRVARVWRn-KSDHIHSMVEWGVSIILLSDCVNSYVRDDNSDIVATDTMKNTVYVKAKECSEQLS 82 
255088958   1 --MPNLVHHVHGKKRVRVARTWR---EGSMHHFVEWNVEVVIESAMAHAYKTPSNEGMTTTDTTKNQCYVVAKAMQKRCS 75 
255551181   4 ELDGFKFEQRHGKDRVRVTRVWR--RNDGNHFMVEWSVSISLLSDCLNAYSRDDNSNIVATDTMKNTVYVKAKECTEQLS 81 
297853380   4 EAHGIRLEQRHGKARVRVGRVWRh-DHDGSHHFVEWNVSISLLSHCLSSYYRDDNSDIVATDTMKNTVYVKAKECGDRLS 82 
302805079   2 PDEIVVKEQCHGKARVRVARVWR--GDGKDHEFVEWTISIILSSDCIPAYSAGDNSSIVATDSIKNTVYALAKLCHQPVS 79 
302833121   1 -MAYALPLHQHGKSKVRLGRVWR---DGNIHHMVEWNVDTMIESDMEHAFVKGENTGMTATDTQKNTVYVVAQRMSQKCT 76 
302781372   2 ADEIVVKEQCHGKARVRVARVWR--GDGKDHEFVEWTISIILSSDCIPAYSAGDNSSIVATDSIKNTVYALAKLCHQPVS 79 
115441235  81 MEEFAVILGRHFTSLYPQ-VSEATVTIAERPWERVVVDGKPHSHGFKL-GVEKHVTEVIVKKS-GNLLINSGIQGYSLLK 157
15225267   83 VEEFAILIGKHFCSFYPQ-VFTAIVNIIEKPWERVSIDGKPHLHGFKL-GSENHTTEARVEKS-GALNLTSGIGGLALLK 159
168048397  79 LEDFGVVVGQHFLRTYPKiVTGAKVILSQKPWERVVVDGVEHNHGFKL-GSGKHTAEVIIGSN-GCVKVTSGITDLSLLK 156
225464393  83 MEEFAIKLAKHFTSFYQQ-VTTAIVTVEEKPWERAYIDGQPHDHGFKR-GSEMHTTEVIVEKS-GALQVTSGIQGLALLK 159
224110112  83 AENFAILLARHFTSFYKQ-VTTAIVKIVEKPWERVHINGQPHEHGFKL-GSEKHTAEVTVQKS-GVLKLTSGIEGLSVLK 159
255088958  76 PEEYALALGKQFVDSYPL-ISAVEVRVEQAPWRRTRVHGADHDHGYTFtAPCLRVCAAVVSRT-KPPAVRSGMRHLRVLK 153
255551181  82 AENFAILLAQHFTSFYKE-VTTAIIKIVEKPWERVSIDDQLHTHGFKL-GSEKHTAEVTLTKS-GDLQLTSGIVGLSVLK 158
297853380  83 VEEFAILIGKHFCSFYPQ-VFTAIVSIIEKPWERVSIDGKPHLHGFKL-GSENHTAEARVEKS-GALNLTSGIGGLALLK 159
302805079  80 IETFGIKLASHFLDTYKE-VTGACVSLVQNNWERVSIDGIPHQHGFKL-GSQKRTAEITISRDkSSVDVVSGFTDLSLLK 157
302833121  77 VEQFAIALAQHFVRTYPL-VSKAKIYVEQKPWNRMQIGGLPHDHGYALaGTEMRTVYVTYDKA-GKLDVTAGLKELSLLK 154
302781372  80 IETFGIKLASHFLDTYKE-VTGACVSLVQNNWERVSIDGIPHQHGFKL-GSQKRTAEITISRDkSSVDVVSGFTDLSLLK 157
115441235 158 TTQSGFEKFVRDRYTLLPDTRERIVATEVTAWWRYPfeHVSQIPSKSFCFTQRYQDVKKVLADTFFGPPDVGVYSPSVQN 237
15225267  160 TTQSGFERFVRDKYTILPETRERMLATEVNASWRYSyeSVASIPTKGLYFSEKFMDVKKVLMDTFFGPPETGVYSPSVQR 239
168048397 157 TTQSGFEKFVRDQFTILPDTDERMLASTITGVWRYA--CISSYSGKPANYQRSWEAVKKVLMDTFFGSPPTGVYSPSVQH 234
225464393 160 TTQAGFEGFIRDKYTALADTRERIVATEVTASWRYPfeSLSGIPLQPLYFTERYLDVKKVLAETFFGPPRGGVYSPSVQS 239
224110112 160 TTKSGFEGFIRDQYTALPETRERMLATEVTALWRYSyeSASSIPKNPLYFTERYLDVKKSLANTFFGPPKEGVYSASVQR 239
255088958 154 TTQSGYEGFLVDKHTALKDTRERIFATAVDVDWTWS--------KPPGCYDNAYTAVYDALAENFFGPPRGGVYSPSVQY 225
255551181 159 TTKSGFEGFIRDKYTALPETRERMLATEVTASWRYLyrSVSTIPQNPLYFTEKYLDVKKVLSNTFFGHPKEGVYSASVQC 238
297853380 160 TTQSGFERFIRDKYTVLPETGERMLATEVNASWRYSyeSVASIPTKGLYFTEKFMDVKKVLVDTFFGPPETGVYSPSVQR 239
302805079 158 TTKSGFEGFIRDKFTLLPEVRERLLASTVTAKWRYA--------RKPSCYTGTYDKVTRTLFETFFGPSKSGVYSPSVQN 229
302833121 155 TTQSGYEGFLRDEYTVLPEVNDRIMASTVTCTWKYT--------TQPSCYDAAFSAAKSGLLDAFLGPAKSGVYSPSVQY 226
302781372 158 TTKSGFEGFIRDKFTLLPEVRERLLASTVTAKWRYA--------RKPSCYTGTYDKVTRTLFETFFGPSKSGVYSPSVQN 229
115441235 238 TLYLMAKEVLNRF--PDIASVQLRMPNLHFIPVNLGNKENpGLVKFADDVYLPTDEPHGTIEATVS-R----PKSKL 307
15225267  240 TLYLMGSAVLKRF--ADVSSIHLKMPNIHFLPVNLSTKENpSMVKFKDDVYLPTDEPHGSIEATLS-R----ITSKL 309
168048397 235 TLYQMAKAVLVRF--PEIENIHLNMPNIHFLPVNLPTVG----VKFENDVFLPTDEPHGSIEAKLS-Rme-iFQCKL 303
225464393 240 TLYQMAKTVLNRF--PDISSIQLKMPNLHFLPVNISSKDNpAIVKFDDDVYLPTSEPHGSIEATVS-R----IRAKM 309
224110112 240 TLFQMAKAVLNRF--PDISSIQLKMPNIHFLPVNISSKEN-TIVKFNDDVFLPTDEPHGSIEASLS-R----FWSKM 308
255088958 226 TLYQMGSAAVERV--DGLEQITLTAPNLHFVPANPPGA-----APFADDVYVATSEPHGQISCTVSaKhgfaPLAKL 295
255551181 239 TLFHMTKAVLNRF--PDISSVQLKMPNLHFLPVNISSKDH-NIVKFNDDVYLPTDEPHGSIEATLS-R----FWGHV 307
297853380 240 TLYLMGSAVLKRF--ADVSSIHLKMPNIHFLPVNLSTKENpSMVKFKDDVYLPTDEPHGSIEATVS-R----ITSKL 309
302805079 230 TLYLMAQEVLRSV--PEVSSIELNMPNLHFLPVNMPTVG----VKFDHDVYLPTSEPHGSIQACLA-Rk--tLTSKL 297
302833121 227 TLYNMAKNLLDRV--PQAESVFLNMPNLHFIPVNPVG------SKFNNDVYVATSEPHGNIEAVVT-RrgmmPHAKL 294
302781372 230 TLYLMAQEVLRRFdvPEVSSIELNMPNLHFLPVNMPTVGV-KVLFFDHDVYLPTSEPHGSIQACLA-Rk--tLTSKL 302
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap