Conserved Protein Domain Family
PLN02414

?
PLN02414: PLN02414 
glycine dehydrogenase (decarboxylating)
Statistics
?
PSSM-Id: 178035
View PSSM: PLN02414
Aligned: 21 rows
Threshold Bit Score: 1753.5
Threshold Setting Gi: 223998052
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219124701    1 MIRRSIALRRILAREKCSRa------------------------------------------------fHASAVFADALD 32  
168056606    1 MERAKHQVAKRLVQQVLPF--------------------------------------------------GARTISIEALK 30  
168004329    1 MERAKQQVVKRLVQQAVRRaaapsapvrsgaalraaagnet-------rrgfgasllrgsgngvvqlplGVRAISVEALK 73  
159469684    1 MRRSAARLLRGVGQAVARSgevaeasavklfdinasrglsaq-----tlsmlgalshaatplpsgfaasGIRSISVAALQ 75  
145351701    1 --------------------------------------------------------------mtsliasGARAVSTEALK 18  
225444934    1 MERARRLANRAILRRVVAEskrhlhisssspalvdssssfrsvssmsllrshlilgsnvrnatgsgvgsQLRSISVESLR 80  
255079794    1 MTRQPSNSKRPFTPCPA----------------------------------------------------AVRTIAVEALK 28  
302796197      --------------------------------------------------------------------------------     
302813487      --------------------------------------------------------------------------------     
302850732    1 -MRRAARLLRGVGQAAQSRfa----------------------------------------------asGVRFIAVDALL 33  
219124701   33 MKDTFARRHVGPSPEDSKSMLATIGFDSFEGLIKSTVPPNIlSPRDLALE----PARTESEALHRIKEMAKKNKVMKSYI 108 
168056606   31 PSDTFQRRHNSPTLEEQKMMAQACGFDSMDAMIDATVPKSI-RRPDLNLSky-gEGLTESQLLAHFKAMASKNKVMKSYI 108 
168004329   74 PSDTFQRRHNSATLEEQKAMAGMCGFEDMDAMIDATVPKSI-RRPDLKLSky-aEGLTESELLAHFKSLASKNKVMRSFI 151 
159469684   76 PSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAIvRKDGMNLGky-hEGMTESQFLEYFKAMASKNKVYKSYI 154 
145351701   19 PLDTFERRHNSGTTQEVAEMCAVIGFKDIDALIDATVPENIrLKKTMDMGey-tQPLTESEFLTMMKNMASKNKVFKNYI 97  
225444934   81 PSDTFPRRHNSATPQEESSMAETCGFSSLDALIDATVPKSI-RIGSMKFSkl-dEGLTESQMIEHMNQLAAKNKVYKSFI 158 
255079794   29 PLDSFERRHNSATKKEEAEMAKYVGFDSMDALVDATVPSDIrRAGSMDMGkw-tQPLSESEFLSTFKSMASKNKVFKSYQ 107 
302796197    1 -------------------MAEVVGFSSMDELVEATVPKPI-KRGPMSLPgkfhEGLTESQMIDHMKYLAAKNKIAKSYI 60  
302813487    1 -------------------MAEAVGFSSMDELVEATVPKPI-KRGPMSLPgkfhEGLTESQMIDHMKYLAAKNKIAKSYI 60  
302850732   34 PSDDFKPRHNSGSPAEIDAMVNMTGFSSLDALIDATVPKAIvRKDGMDLGky-hEGMTESQFLSYFKSMAGKNKVLKSFL 112 
219124701  109 GAGYYDTQVPPVILRNMLENPGWYTAYTPYQAEISQGRLEMLLNFQTLVVDLTGLPMAVASLLDEATAAGEAMQMTFALk 188 
168056606  109 GMGYYDTHVPTVILRNILENPGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGMPMSNASLLDEGTAAAEAMTMCSNI- 187 
168004329  152 GMGYHDTHVPTVILRNILENPGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGMPMSNASLLDEGTAAAEAMTMCSNI- 230 
159469684  155 GMGYYGTHVPNVILRNVLENPGWYTQYTPYQAEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAI- 233 
145351701   98 GTGYHGTHVPTVILRNILENPGWYTQYTPYQAEASQGRLESLLNFQTMITDLTGMPLSNSSLLDEGTAAAEAMTMCSAL- 176 
225444934  159 GMGYYGTLVPHVILRNIMENPGWYTQYTPYQAEISQGRLESLLNYQTMVSDLTGLPMSNASLLDEGTAAAEAMAMCNNI- 237 
255079794  108 GTGYYGTHVPTVILRNVLENPGWYTQYTPYQAEIAQGRLESLLNYQTMISDLTALPMANASLLDEGTAAAEAMTMCSAV- 186 
302796197   61 GMGYYNTIVPPVILRNIMENPGWYTQYTPYQAEIAQGRLESLLNYQTMIAELTGLPMSNASLLDEGTAAAEAMGMCLNI- 139 
302813487   61 GMGYYNTIVPPVILRNIMENPGWYTQYTPYQAEIAQGRLESLLNYQTMVAELTGLPMSNASLLDEGTAAAEAMGMCLNI- 139 
302850732  113 GMGYYDVHVPPVILRNVLENPGWYTQYTPYQAEIAQGRLESLLNFQTMVCDLTGMSISNASLLDEATAAAEAMTMCSAV- 191 
219124701  189 gKKGKKNKFFVSQDVHPQTIGLIQTRAEAIGIEVIVGEHSKSDFSAGDYCGAMVQYPNTYGEIesggESYEAFTARAHEG 268 
168056606  188 -ARGRKKTFLVADNCHPQTIEVCKTRADGLGLNVVVADYKKFDYSSKDVSGVLVQYPATDGSV----NDYSDFVKNAHAH 262 
168004329  231 -ARGRKKTFLVADNCHPQTIEVCKTRADGLGLNVVVADYKKFDYSSKDVSGVLVQYPATDGSV----NDYSDFVKNAHAH 305 
159469684  234 -ARGKKPKFLVSSKCHPQTIAVCQTRAEGLGLEAVVVDEDKMAYAK-DVCGVLLQYPATDGSI----SDYKALVAKAHAA 307 
145351701  177 -NRGKKPKFYVSNKCHPQTIAVVQTRAEGLGLEAVVGDENSFDYTAKDVCGVLVQYPATDGSI----IDYKPIVSQAQAN 251 
225444934  238 -QKGMKKTFLIANNCHPQTIDVCKTRADGFGLKVVTLDLKDFDYKSGDVCGVLVQYPGTEGEV----LDYGEFIKKAHAN 312 
255079794  187 -NRGKKPKFLISDKCHPQTIEVCRTRADGLGLTVVVGDENSFDYSGNDVCGVLLQYPATDGAV----IDYSPVVKSAHAA 261 
302796197  140 -GSRKRPKFLIASNCHPQTIDVCVTRADGLGMTASIVDPDKFEFSK-DVCGVLVQYPATDGSI----TDYASLISSAHAN 213 
302813487  140 -GSRKRPKFLIASNCHPQTIDVCVTRADGLGMTASIVDPDKFEFSK-DVCGVLVQYPATDGSI----TDYASLVSSAHAN 213 
302850732  192 -ARGKKPKFLVSSKCHPQTIAVCQTRAEGLGLEAVVADEDKFVYGK-DVCGVLVQYPATDGTV----SDYKALVAAAHAA 265 
219124701  269 NAMVIAATDLLALTKLAPPSTWGADIAVGSAQRFGVPMGFGGPHAGFLSTSDQYSRKMPGRIIGVTVDSYGKPCLRMAMQ 348 
168056606  263 GVKVVMATDLLSLTMLTPPGELGADMVVGSAQRFGVPMGYGGPHAAFLATSQEYKRLMPGRIIGISIDATGKPCLRMAMQ 342 
168004329  306 GVKVVMATDLLSLTVLTPPGELGADMVVGSAQRFGVPMGYGGPHAAFLATSQEYKRLMPGRIIGMSIDATGKPCLRMAMQ 385 
159469684  308 NVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGYGGPHAAFLACHDEFKRLMPGRIIGMSIDAQGKPALRMAMQ 387 
145351701  252 GIRVVAAADLLSLTMLQPPGEWGADIVIGSSQRFGVPMGYGGPHAAFLATTHDCKRLMPGRIIGESIDAEGKPALRMAMQ 331 
225444934  313 GVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSSGKPALRMAMQ 392 
255079794  262 GAKVVAAADLLALTSLVPPGEWGADICIGSAQRFGVPMGFGGPHAGYLATSHDYKRLMPGRIIGVSIDATGAPALRMAMQ 341 
302796197  214 GVKVVVATDLLALTCLKPPGEIGADMAVGSAQRFGVPLGYGGPHAAFLATSQEYKRMMPGRIIGVSVDSNGKPALRMALQ 293 
302813487  214 GVKVVVATDLLALTCLKPPGEIGADMAVGSAQRFGVPLGYGGPHAAFLATSQEYKRMMPGRIIGVSVDANGKPALRMALQ 293 
302850732  266 NVKVCVSTDLLALTMLTPPGEWGADIVVGSAQRFGVPMGYGGPHAAFLACHDEYKRLMPGRIIGMSIDAQGKPALRMAMQ 345 
219124701  349 TREQHIRRDKATSNICTAQALLANMAAAYAIYHGPKGLADIAGRVHALAAVGHREIGKAG-FKVTEGPFFDTFTVDVSSK 427 
168056606  343 TREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIANRVHGLAAVFSSGVKRLG-FQVGSASFFDTVKVTVGEG 421 
168004329  386 TREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKTIANRVHGLAAVFSAGVSKLG-FQTGSAPFFDTVKVTVGEG 464 
159469684  388 TREQHIRRDKATSNICTAQALLANMAALYAVYHGPEGLKTIAHRVNGLASVFAAGAAKLG-HTVPSAPFFDTVSVTVKDG 466 
145351701  332 TREQHIRRDKATSNICTAQALLANIAAMYGVYHGPEGLKQIAKRSHDFAAVFAAGAEKLG-FKNTTPEFFDTVTLKCPSG 410 
225444934  393 TREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKTIAQRVHGLAATFAYGLKKLGtVDPQGIPFFDTVKIKCSDS 472 
255079794  342 TREQHIRRDKATSNICTAQALLANMAGLYAVYHGPKGLKAIADKTHGLASIFAEGAGKMG-FAKPAAPFFDTVALGCPSG 420 
302796197  294 TREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKAIADRVHGLATVFSEGVKKLG-YQVGSDPFFDTVKVSASNA 372 
302813487  294 TREQHIRRDKATSNICTAQALLANMSAMYAVYHGPEGLKAIADRVHGLATVFSEGVKKLG-YQVGSDPFFDTVKVSASNA 372 
302850732  346 TREQHIRRDKATSNICTAQALLANMAALYAVYHGPEGLKTIARRVNGLASVLAAGASKLG-HGVPSAPFFDTVT------ 418 
219124701  428 gmnaTEVQAGAASVGANVRVIDEKRVGVAMGEGITRDDLGKLLSGAFKISSPDLSADDSLSNLDP----AVAREGEILTH 503 
168056606  422 q--aEKIKNDAAAHGVNLRVFDSNSVTLSFDETTTIGDVNTLFKCFAGGKNVDFSAEQLAAGVEShlpsNLKRETPFLTH 499 
168004329  465 q--vEKVMKDAVAHGVNLRQLDSSSVTLSFDETTTIGDVNTLFKIFGGGKNVGFTAEQLAGEVESrlpsSLKRDTPFLTH 542 
159469684  467 d--aDKYVALALNEKINIRKLSKNTISLAFDETSSVADVDALLRVLNCGRDAPFTAASLAPAVEGgv-gGFARKSTFLQQ 543 
145351701  411 a---DAIVKACASAGINIRKMDADHVSLAFDETTEIADVDALFKVFAGGAAAP-TVAQVAPSVNTt--mPMARKSEFMTH 484 
225444934  473 ----RAIADAAYKKEMNLRILDSNTITVSFDETTTLEDVDKLFKVFSCGKPVTFTAASLAPEVDTmippGLVRESSYLTH 548 
255079794  421 a---DKAVADCQKAGINIRKIDANTVSLSFDETTTMGDVDALFAALNGGSAPAFTAEALAPSVNAs--dFLARKSRFLTH 495 
302796197  373 ----SSLAETAAKEGINLRVLDANTVTVAFDETITLEDVDNLFKVFAKGKRVNFTAESLAPSAGSslpkEMVRESAYLTH 448 
302813487  373 ----SSLAETAAKEGINLRVLDANTVTVAFDETITLEDVDNLFKVFAKGKQVNFTAESLAPYAGSslpkEMVRESAYLTH 448 
302850732  419 ---------------MNIRKIAPNAISIAFDETSTLADVDALLRVLNNGQDAPFNAAALAPAVEGgv-gPFARQSPFLQQ 482 
219124701  504 PIFRQHHSETQMLRYLKTLENRDLALNHSMISLGSCTMKLNATSEMIPVTWPEFSDIHPFAPHDQTIGYHEMIEDLNKDL 583 
168056606  500 PVFNQYHSEHELLRYLHRLQAKDLSLVHSMIPLGSCTMKLNATTEMIPITWPEMANLHPFAPEDQAQGYQEMFKELGDLL 579 
168004329  543 PVFNQYHSEHELLRYLHRLQAKDLSLVHSMIPLGSCTMKLNATTEMIPITWPEMANLHPFAPEDQAQGYQEMFKELGDLL 622 
159469684  544 PIFNTYHNEHDMLRYLKRLENKDLSLVHSMIPLGSCTMKLNATAEMMPITWPELAALHPFVPVDQAEGYAEMFRDLSAQL 623 
145351701  485 PVFNQYHSEHEMVRYLKRLEEKDLSLVHSMIALGSCTMKLNATTEMIPITWPELANIHPFAPKDQTLGYQEMFRGLEKQL 564 
225444934  549 PIFNSYHTEHELLRYIHRLQAKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPIDQAQGYQEMFNDLGELL 628 
255079794  496 PVFNAYHSEHEMLRYLARLEAKDLSLVHSMIALGSCTMKLNSTTEMIPITWPELANMHPFAPKEQTAGYREMFQELEKQL 575 
302796197  449 PIFNSYHSEHELLRYLHRIQAKDLSLVHSMIPLGSCTMKLNATVEMMPVTFPEFANIHPFAPLDQTGGYQEMFKNLGDFL 528 
302813487  449 PIFNSYHSEHELLRYLHRIQAKDLSLVHSMIPLGSCTMKLNATVEMMPVTFPEFANIHPFAPLDQTGGYQEMFKNLGDFL 528 
302850732  483 PIFNTYHNEHDMLRYLKRLENKDLSLAHSMIPLGSCTMKLNATSEMMPVTWPELANLHPYCPPDQAEGYNEMFRDLAAQL 562 
219124701  584 SEITGFAAVSAQPNSGATGEYAGLLAITKYLESTGEGHRNVCLIPKSAHGTNPASAVMAGMKVVVVENDDQGNVDFGDLT 663 
168056606  580 CEITGFDSMSLQPNAGAAGEYTGLMVIRAYHLARGDAHRDVCIIPVSAHGTNPASAAMCGMKIVTVGTDAHGNVDIAELR 659 
168004329  623 CEITGFDSMSLQPNAGAAGEYAGLMVIRAYHLARGDAHRDVCIIPVSAHGTNPASAAMCGMRIVTVGTDKHGNVDIAELR 702 
159469684  624 CSITGFDAMSLQPNSGASGEYAGLMAIRAFHLSRNEGHRNVCIIPVSAHGTNPASAVMAGMKIVTVSTDSQGNVNIPELR 703 
145351701  565 CEITGFDAMSLQPNSGASGEYAGLMGIRAYHQSRGDHHRDVCIIPVSAHGTNPASAAMCGMKIVVIGTDAKGNINVAELK 644 
225444934  629 CTITGFDSFSLQPNAGAAGEYAGLMVIRAYHLARGDHHRNVCIIPVSAHGTNPASAAMCGMKIVAVGTDAKGNINIKELR 708 
255079794  576 CEITAFDAMSLQPNSGASGEYAGLMAIRAYHQSRGDHHRDVCIIPVSAHGTNPASAAMVGYKIVVVGTDAQGNINIPELK 655 
302796197  529 CEITGFDSVSLQPNAGAAGEYTGLMVIRAYQKAKGEGHRNVCIIPVSAHGTNPASAAMCGMKIVSIGTDANGNVDIAELK 608 
302813487  529 CEITGFDSVSLQPNAGAAGEYTGLMVIRAYQKAKGEGHRNVCIIPVSAHGTNPASAAMCGMKIVSIGTDANGNVDIAELK 608 
302850732  563 CSITGFDAVSLQPNSGASGEYAGLMAIRSYHLARGDAHRNICIIPVSAHGTNPASAVMAGMKIVTVSTDAHGNVNIAELK 642 
219124701  664 AKISKHKDNLAAFMVTYPSTFGVFEERIVEICDAIHDAGGQVYMDGANMNAQVGLTSPGLIGADVCHLNLHKTFCIPHGG 743 
168056606  660 KAAEKHKDNLSALMVTYPSTHGVYEEGIDEICNIIHQYGGQVYMDGANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGG 739 
168004329  703 KAAEKHKDNLSALMVTYPSTHGVYEEGIDEICNIIHQYGGQVYMDGANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGG 782 
159469684  704 AKAEEHSKNLAALMITYPSTHGVYEDGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGLIGADVCHLNLHKTFCIPHGG 783 
145351701  645 AAAEKHSANLAALMVTYPSTHGVYEEDIKEICEVIHQHGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGG 724 
225444934  709 KAAEANRDNLSALMVTYPSTHGVYEEGIDEICKIIHENGGQVYMDGANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGG 788 
255079794  656 AAAEKHSANLAALMVTYPSTHGVYEDGIKDVCDTIHKHGGQVYMDGANMNAQVGLTAPGIIGADVCHLNLHKTFCIPHGG 735 
302796197  609 QAAEANKDNLSALMVTYPSTHGVYEDGIDDICDIIHKNGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGG 688 
302813487  609 QAAEANKDKLSALMVTYPSTHGVYEDGIDDICDIIHKNGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGG 688 
302850732  643 QKAEQHSKNLAALMITYPSTHGVYEEGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGIIGADVCHLNLHKTFCIPHGG 722 
219124701  744 GGPGVGSIGVREHLAPFLPGHVMDPQASGkLCGNDicvPKTEGAVAAAPFGSAAILPISWMYIKMLGAEGLKAATSHAIL 823 
168056606  740 GGPGMGPIGVKKHLAPFLPSHPVVGTGGF-PRPAN---TQPLGPISAAPYGSALILPISYIYIAMMGNKGLTDASKLAIL 815 
168004329  783 GGPGMGPIGVKKHLAPFLPSHPVVGTGGF-PRPAN---TQPLGPISAAPYGSALILPISYSYIAMMGNKGLTDASKLAIL 858 
159469684  784 GGPGMGPIGVKAHLAPFLPTHPVVPTGALpSRPAD---PKPFGTMAAAPFGSSLILPISYAYISMMGSAGLTMASKLAIL 860 
145351701  725 GGPGMGPIGVKAHLAPFMPDHPSMKDGAVaVGGDK-----PFGVVAAAPYGSALILPISFSYIAMMGSEGLANASKRAIL 799 
225444934  789 GGPGMGPIGVKKHLAPFLPAHPVVPTGGI-PSSEN---AQPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKIAIL 864 
255079794  736 GGPGMGPIGVKKHLAPFMPDHPSAELDGAtPAGGE----TPFGVVSAAPYGSALILPISFAYISMMGSEGLTNASKRAIL 811 
302796197  689 GGPGMGPIGVKKHLTPFLPSHPVVSTGGIpPSSEK---AQPLGTISAAPWGSALILPISYTYIAMMGSEGLTSASKLAIL 765 
302813487  689 GGPGMGPIGVKKHLTPFLPSHPVVSTGGIpPSSEK---AQPLGTISAAPWGSALILPISYTYIAMMGSEGLTSASKLAIL 765 
302850732  723 GGPGMGPIGVKAHLAPYLPTHPVIPTGALpVRPAA---PQPFGTMAAAPYGSSLILPISFAYISMMGSGGLTMASKLAIL 799 
219124701  824 NANYMAARMNGAYDVLFTGKNGQCAHEFILDLRPLKAATGVTEEDVAKRLQDYGFHSPTMSWPVAGTLMIEPTESEDLGE 903 
168056606  816 NANYMAKRLENHYPILFRGVNGTCAHEFIIDLRKFKDTAGIEAEDVAKRLMDYGYHAPTMSWPVSGTLMIEPTESESKAE 895 
168004329  859 NANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVAKRLMDYGYHAPTMSWPVSGTLMIEPTESESKAE 938 
159469684  861 KANYMAKRLAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVAKRLMDYGFHAPTMSWPVPGTLMIEPTESESKEE 940 
145351701  800 NANYMSKRLEDYYPVLFSGKNDTCAHEFILDMRPIKDATGVEVADIAKRLMDYGFHSPTMSWPVAGTLMIEPTESESKAE 879 
225444934  865 KANYMAKRLEDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAE 944 
255079794  812 NANYMKKRLEDHFPILFTGKNGTCAHEFIIDLRPMTDKTGIGPEDVAKRLQDYGYHAPTMSWPVSGTLMIEPTESESKQE 891 
302796197  766 NANYMAKRLENHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVAKRLIDYGFHAPTMSWPVHGTLMIEPTESESKAE 845 
302813487  766 NANYMAKRLEDHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVAKRLIDYGFHAPTMSWPVHGTLMIEPTESESKAE 845 
302850732  800 KANYMAKRLAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVAKRLMDYGFHAPTMSWPVPGTLMIEPTESESKDE 879 
219124701  904 LDRFCDAMLSIRAEIDDIGSGRIALEDSPLHYAPHTMNDLVNEKWDRPYSKEVGIYPAPWIRANKFWPSCGRVDNVYGDR 983 
168056606  896 LDRFCDALISIRGEIAAIENGEASREDNVLKGSPHPASVVMADNWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDR 975 
168004329  939 LDRFCDALISIREEIAAIENGEASREDNVLKGAPHPASVVMADDWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDR 1018
159469684  941 LDRFCEAMISIREEIREIESGKADKANNILKHAPHAPGVVLADKWERPYSRERAAFPAPWVRQAKFWPTVSRVDNVYGDR 1020
145351701  880 LDRFCDALIAIRGEIRDIEDGKVDRENNVLKNAPHTAEVVTAKEWNRPYPRDLGAFPVEWTRSHKFWPQTSRIDDVYGDR 959 
225444934  945 LDRFCDALISIREEIAQIEKGKADPNNNVLKGAPHPQSLLMQDAWTKPYSREYAAFPASWLRAAKFWPSTGRVDNVYGDR 1024
255079794  892 LDRFCNAMIAIREEIRDIENGAIDKENNPLKHAPHTAAVVLSDKWDRPYSRETAAFPAEWVRQSKFWPTTSRIDNVYGDR 971 
302796197  846 LDRFCDAMISIREEIRAIENGTCNAADNVLKGAPHSASMVLSDKWNKPYSRKLAAYPATWVESSKFWPSTGRVDNVYGDR 925 
302813487  846 LDRFCDAMISIREEIRAIENGTCNAADNVLKGAPHSASMVLSDKWNKPYSRKLAAYPATWVESSKFWPSTGRVDNVYGDR 925 
302850732  880 LDRFCEAMISIREEIREIEQGRADRENNVLKHAPHAPSVVLVDTWDRPYTRERAAYPAPWVWQAKFWPTVSRVDNVYGDR 959 
219124701  984 NLVCTCPplDVYEDDDDKKLAA 1005
168056606  976 NLVCTNP--PAELVEEKIAAAA 995 
168004329 1019 NLMCTNP--SAEVIDEKIAAAA 1038
159469684 1021 HLITRWD---NGTSAEAVAAHA 1039
145351701  960 NLVASRA-----AVEVAVAQTA 976 
225444934 1025 NLTCTLLspSQAAEEQKAAATA 1046
255079794  972 NLVTTHA-----QVEVAAEETA 988 
302796197  926 NLVCTLIn-GDATPAEERVATA 946 
302813487  926 NLVCTLIn-GDAAPAEERVATA 946 
302850732  960 NLVTRWA---SAEAAEPVAATA 978 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap