Conserved Protein Domain Family
PLN02412

?
PLN02412: PLN02412 
probable glutathione peroxidase
Statistics
?
PSSM-Id: 166053
View PSSM: PLN02412
Aligned: 6 rows
Threshold Bit Score: 335.035
Threshold Setting Gi: 297826597
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225103    1 MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGN 80 
224095706   1 MAEESPKSIYDFTVKDIHGNDTSLSEYSGKVLLIVNVASKCGLTHSNYKELNVLYEKYKNQGFEILAFPCNQFAGQEPGS 80 
225433843   1 MAEAAPKSIYDFTVKDIRGNDVSLSDYNGKVLLIVNVASKCGLTHSNYKELNVLYEKYKSQGFEILAFPCNQFLGQEPGS 80 
255577761   1 MAEESSKSIYDFTVKDIRGNDVSLNEYSGKVLLIVNVASKCGLTQSNYKELNVLYEKYKNQGFEILAFPCNQFAGQEPGS 80 
297826597   1 MADESPKSIYDFTVKDIGGNDVSLNQYKGKTLLIVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGN 80 
297788336   1 MADESPKSIYDFTVKDIGGNDVSLNQYKGKTLLIVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGN 80 
15225103   81 NEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDI 160
224095706  81 NEEIQDTVCTIFKAEFPIFDKIDVNGKNTAPVYKFLKSEKGGYFGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDI 160
225433843  81 NEEILEAACTMFKAEFPIFDKVEVNGKNTAPLYKFLKLQKGGLFGDGIKWNFTKFLVDKEGKVVDRYAPTTSPLKIEEDI 160
255577761  81 NEEIQEVACTMFKAEFPIFDKIEVNGKNTAPLYKYLKSEKGGYFGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDI 160
297826597  81 NEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDV 160
297788336  81 NEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDI 160
15225103  161 QTALGQA 167
224095706 161 QNLLGSS 167
225433843 161 QNLLGSA 167
255577761 161 QNLLGAS 167
297826597 161 QTLLGQA 167
297788336 161 QTLLGQA 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap