Conserved Protein Domain Family
PLN02411

?
PLN02411: PLN02411 
12-oxophytodienoate reductase
Statistics
?
PSSM-Id: 178033
View PSSM: PLN02411
Aligned: 11 rows
Threshold Bit Score: 753.227
Threshold Setting Gi: 255567027
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225045    1 MTAAQGNSNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGI 80 
42570715    1 MTAAQGNSNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGI 80 
115476758   5 PPDQQRQKQAPLFSPYQMPRFRLNHRVVLAPMTRCRAIGGVPGPALAEYYAQRTTQGGLLISEGTVVSPAGPGFPHVPGI 84 
145328276   1 MTAAQGNSNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGI 80 
242079415  12 DQQQQQPQRPSLFSPYQMPRFRLAHRVVLAPMTRCRAPDAIPGPALAEYYAQRSTEGGLLISEGTIISPSGPGFPRVPGI 91 
225444756   1 MAESSAEGTTTLFSPYKMGRFQLSHRVALAPMTRCRAMNGIPQPALAEYYSQRSTNGGFLITEGTLISPTAAGFPHVPGI 80 
224122450   1 -----------------MGKFSLSHRVVLAPMTRCRALNGIPGDALAEYYAQRSTPGGFLITEGALISPTAPGFPHVPGI 63 
224132506   1 ----MAEEGISLFSPYKMGKFSLSHRVVLAPLTRCRALGGIPGDALVEYYTQRSTPGGFLITEGTLISPTAPGFPHVPGI 76 
255567027   1 ------MRPHYFLLTIRASLTCLTGQMVLAPLTRCRALNGIPTAAMVEYYVQRSTAGGLIITEGTLISPTAIGFPNVPGI 74 
255550473   1 ------MAETTLFSPYKMGRFNLSHRVVLAPMTRCRALNGIPNAALAEYYTQRSTPGGFLITEGTLVSPTAPGFPHVPGI 74 
297835862   1 MTAAQKNSNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGI 80 
15225045   81 YSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNG-GSPISSTNKPISENrWRVLLPDGSHVKYPKPRALEAS 159
42570715   81 YSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNG-GSPISSTNKPISENrWRVLLPDGSHVKYPKPRALEAS 159
115476758  85 YNQEQTDAWKKVVDAVHAKGGIFFCQLWHVGRASHQVYQPNG-AAPISSTDKPISAR-WRILMPDGSYGKYPKPRRLAAS 162
145328276  81 YSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNG-GSPISSTNKPISENrWRVLLPDGSHVKYPKPRALEAS 159
242079415  92 YNQEQTDAWRKVVDAVHAKGAIFFCQLWHVGRASHQVYQPGG-AAPISSTDKPISSR-WRILMPDGSYGKYPTPTRLATS 169
225444756  81 YTGEQVEAWKKVVEAVHAKGAIIFCQLWHVGRASHQVYQPGGtGAPISSTSKPIAGR-WRILMPDGSHGKYPAPRALKTS 159
224122450  64 YSDAQVEAWKKVVDAVHAKGSVIFCQLWHVGRASHQVYQPGG-VPPISSTNKPISNR-WRILMPDGTYGIYPAPRALKTS 141
224132506  77 YSDAQVEAWKKVVNAVHAKGSIIFCQLWHVGRASHQVYQPGG-AAAISSTNKAISNR-WRILMPDGTYSTCSAPRALETS 154
255567027  75 YLDEQVEAWKKIVDAVHAKGSFIFCQLWHVGRASHYDYQPDG-AAPISSTGKVISDE-YQILMPDGTSTTYSKPRPLEIS 152
255550473  75 YTEEQVEAWKKVVDEVHAKGSIIFCQLWHVGRASHQVYQPGG-AAPISSTSKAISNR-WRILMPDGSYGTYPTPRALETS 152
297835862  81 YSDEQVEAWKQVVDAVHAKGGFIFCQLWHVGRASHPVYQPNG-GSPISSTNIPISEKrWRVLLPDGSYAKYPKPRALEAS 159
15225045  160 EIPRVVEDYCLSALNAIR----------------AGFDGIEIHGAHGYLIDQFLKDGINDRTDQY-------GGSIANRC 216
42570715  160 EIPRVVEDYCLSALNAIR----------------AGFDGIEIHGAHGYLIDQFLKDGINDRTDQY-------GGSIANRC 216
115476758 163 EIPEIVEQYRQAAINAIE----------------AGFDGIEIHGAHGYIIDQFLKDGINDRTDEY-------GGSLSNRC 219
145328276 160 EIPRVVEDYCLSALNAIR----------------AGFDGIEIHGAHGYLIDQFLKDGINDRTDQY-------GGSIANRC 216
242079415 170 EIPEIVEQYRQAAINAIK----------------AGFDGIEIHGAHGYLIDQFLKDGINERTDEY-------GGSLSNRC 226
225444756 160 EIPEVVEHYRQSALNAIA----------------AGFDGIEIHGAHGYLIDQFLKDGINDRTDEY-------GGSISNRC 216
224122450 142 EILELVEHYSQAALNAIR----------------AGFDGVEIHGAHGYLIDQFLKNGINDRVDEY-------GGSIENRC 198
224132506 155 EILEVVEHYSQAALNAIR----------------AGFDGVEIHGGYGYLIDQFLKDGINDRIDDLchtsaydGGSMENRC 218
255567027 153 EIPTVVEHYRQAAVNAIRaalvlelaaglklhqhAGFDGVEIHGAFGYIIDQFLKDGINDRMDEY-------GGSIENRC 225
255550473 153 DIQEVVETYRQAALNAIR----------------AGFDGIEIHGAHGYLIDQFLKDGINDRTDEY-------GGSINNRC 209
297835862 160 EIPRVVEDYCRSALNAIR----------------AGFDGIEIHGAHGYLIDQFLKDGINDRTDEY-------GGSIANRC 216
15225045  217 RFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQTESGRQ 296
42570715  217 RFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQTESGRQ 296
115476758 220 RFLLEVTRAVVSAIGADRVAVRISPAIDHLDAYDSDPIKLGMAVVERLNALQQQSG-RLAYLHVTQPRYTAYGQTESGQH 298
145328276 217 RFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQTESGRQ 296
242079415 227 RFLLEVTRAVVSAIGADRVAVRVSPAIDHLDAYDSNPLQLGLAVVDRLNALQQEVGRLLAYFHVTQPRYTAYGQTESGQH 306
225444756 217 KFLVQVVQAVAAAIGPDRVGVRVSPAIDHLEATDSNPLNLGLAVIERLNKLQLDWGSKLTYLHVTQPRYTAYGQTESGRH 296
224122450 199 RFMMQVIQAVVSAVGAERVAFRMSPAIDHLDATDSDPLNLGLSVIERINKLQLQVGSKLTYLHVTQPRYTASGQTESRRT 278
224132506 219 RFLMQVIQAVVSAVGAERVAFRTSPAIDHNDATDSDPLNLGLSVIERINKLQLQVGSKLTYLHV---------QRELGRP 289
255567027 226 RFMMQVVQAVVSAIGIDRVGFKMSPSTFHNDAIDSDPLKLGLGIIDRLNKLQSQLGSKLAFLQLQT------------EY 293
255550473 210 RFLMQVIEAVVAAIGADRVGFRMSPAIDHLDAMDSDPLNLGLAVIERLNRLQLNLGSKLTYLHVTQPRYTAYGQTESGRH 289
297835862 217 RFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVDLLNKLQDVNGSKLSYLHVTQPRYHAYGQTESGRQ 296
15225045  297 GSDEEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPV 376
42570715  297 GSDEEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPV 376
115476758 299 GSAEEESRLMRTLRGTYQGTFMCSGGYTRELGLEAVESGDADLVSYGRLFISNPDLVERFRLNAGLNKYVRKTFYTPDPV 378
145328276 297 GSDEEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPV 376
242079415 307 GSAEEESRLMRALRGAYRGTFMCSGGYTRELGVEAVESGDADLVSYGRLFIANPDLVERFRRDAPLNKYVRKTFYTPDPV 386
225444756 297 GSEEEEAQLMRTWRRAYQGTFICSGGFTRELGLEAVALGDADLVSYGRLFISNPDLVLRLKVNAPLNRYIRAYFYTQDPV 376
224122450 279 GSEDEEAQMIRTWRRAYQGTFMCSGGFTRELGIQAVTEGDADLVSYGRLFISNPDLVLRLKLNAPLNKYIRKTFYTQDPV 358
224132506 290 GTEDVVAQTTRTWRRAYQGTFICSGGFTRELGTQAVAEGDADLVSYGRDFISNPDLVLRLKLNAPLNKYIRETFYTHDPI 369
255567027 294 GSENEQVQFLRTWRRAFHGTFMCTGGFTRELGMQAVGDGDADLVSYGRLFLSNPDLVLRFKLNAPLNKYDRETFYTSDPV 373
255550473 290 GTEDEEARLMRTWRNGYQGTFICSGGFTRELGIEAIAEGNADLVSYGRVFISNPDLVLRLKLNAPLNKYIRKTFYTPDPV 369
297835862 297 GSDEEEAKLMRSLRMAYNGTFMSSGGFNKDLGMQAIQQGDADLVSYGRLFIANPDLVSRFKIDAKLNKYNRKTFYSQDPV 376
15225045  377 VGYTDYPFLA--------PFSRL 391
42570715  377 VGYTDYPFLA--------PFSRL 391
115476758 379 VGYTDYPFLGq-------PKSRM 394
145328276 377 VGYTDYPFLA--------PFSRL 391
242079415 387 VGYTDYPFLGq-------PKARM 402
225444756 377 KGYTDYPFLNkgse-shePLSRL 398
224122450 359 VGYTDYPFLSkang-vqvPLSRL 380
224132506 370 VGYTDYPFLSkasg--------- 383
255567027 374 IGYTDYPFLSqltdgkeePFSHP 396
255550473 370 VGYTDYPFLSkeng-sqqLLSRL 391
297835862 377 VGYTDYPFLA--------AFSRL 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap