Conserved Protein Domain Family
PLN02410

?
PLN02410: PLN02410 
UDP-glucoronosyl/UDP-glucosyl transferase family protein
Statistics
?
PSSM-Id: 178032
View PSSM: PLN02410
Aligned: 3 rows
Threshold Bit Score: 951.02
Threshold Setting Gi: 18408251
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18408251    6 MEEKPARRSVVLVPFPAQGHISPMMQLAKTLHLKGFSITVVQTKFNYFSPSDDFThDFQFVTIPESLPESDFKNLGPIQF 85 
15232618    1 MEEKPAGRRVVLVAVPAQGHISPIMQLAKTLHLKGFSITIAQTKFNYFSPSDDFT-DFQFVTIPESLPESDFEDLGPIEF 79 
297819238   1 MEEKLARRRVLLVPVPAQGHISPMMQLAKTLYLKGFSITIAQTKFNHFSPSDDFT-DFQFVTIPESLPESDFKNLGPIEF 79 
18408251   86 LFKLNKECKVSFKDCLGQLVLQQSNEISCVIYDEFMYFAEAAAKECKLPNIIFSTTSATAFACRSVFDKLYANNVQAPLK 165
15232618   80 LHKLNKECQVSFKDCLGQLLLQQGNEIACVVYDEFMYFAEAAAKEFKLPNVIFSTTSATAFVCRSAFDKLYANSILTPLK 159
297819238  80 LHKLNKECQVSFKDCLGQLFLQQGNEIACVVYDEFVYFAEAAAKEFKLPNVIFSTTSATAFVCRSVFDKLYANNVLAPLK 159
18408251  166 ETKGQQEELVPEFYPLRYKDFPVSRFASLESIMEVYRNTVDKRTASSVIINTASCLESSSLSFLqQQQLQIPVYPIGPLH 245
15232618  160 EPKGQQNELVPEFHPLRCKDFPVSHWASLESMMELYRNTVDKRTASSVIINTASCLESSSLSRL-QQQLQIPVYPIGPLH 238
297819238 160 EPKGQQNELVPEFHPLRCKDFPVSHWASLESIMELYRNTVDTRTASSVIINTASCLESSSLSRL-QQQLKIPMYPIGPVH 238
18408251  246 MVASAPTSLLEENKSCIEWLNKQKVNSVIYISMGSIALMEINEIMEVASGLAASNQHFLWVIRPGSIPGSEWIESMPEEF 325
15232618  239 LVASASTSLLEENKSCIEWLNKQKKNSVIFVSLGSLALMEINEVIETALGLDSSKQQFLWVIRPGSVRGSEWIENLPKEF 318
297819238 239 LVASTPTSLLEENKSCIEWLNKQKKNSVIFVSLGSLALMEINEVMETASGLDSSNQQFLWVIRPGSVRGSTWIEYLPKEF 318
18408251  326 SKMVLDRGYIVKWAPQKEVLSHPAVGGFWSHCGWNSTLESIGQGVPMICRPFSGDQKVNARYLECVWKIGIQVEGELDRG 405
15232618  319 SKIISGRGYIVKWAPQKEVLSHPAVGGFWSHCGWNSTLESIGEGVPMICKPFSSDQMVNARYLECVWKIGIQVEGDLDRG 398
297819238 319 SKIISGRGYIVKWAPQKEVLSHPAVGGFWSHCGWNSTLESIGEGVPMICKPFSSDQKVNARYLECVWKIGIQVEGDLDRG 398
18408251  406 VVERAVKRLMVDEEGEEMRKRAFSLKEQLRASVKSGGSSHNSLEEFVHFIRTL 458
15232618  399 AVERAVRRLMVEEEGEGMRKRAISLKEQLRASVISGGSSHNSLEEFVHYMRTL 451
297819238 399 AVERAVKRLMVEEEGEEMRKRAISLKEQLRASVISGGSSHNSLEKFVHFMRTL 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap