Conserved Protein Domain Family
PLN02409

?
PLN02409: PLN02409 
serine--glyoxylate aminotransaminase
Statistics
?
PSSM-Id: 178031
View PSSM: PLN02409
Aligned: 21 rows
Threshold Bit Score: 598.278
Threshold Setting Gi: 302835409
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168021131   1 MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTGTPFIFPSSGTGAWESALTNT 80 
168063179   1 MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTATSFIFPTTGTGAWESALTNT 80 
168005939   1 MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTATSFIFPTTGTGAWESALTNT 80 
159488202  44 PFSYVPPGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNT 123
159488204  33 PFSYVPPGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAEFYKECLEDTKHMYGTKAATPFIFPGTGTGGWEAALCNT 112
159487068  47 CDGVLEVPSRLLMGPGPANAYPRILTAQALPLLGHMHPPFLKIMDELSEGLRYTFQTKSKYTLMVSGTGHAGMEAAIANL 126
302774927   1 MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSGTPFIIPTTGTGGWECAAVNT 80 
302772394   1 MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSGTPFIIPTTGTGGWECAAVNT 80 
302844450  46 PFSYVPPGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAQFFKDCLEDTKLIYGTKEATPFIFSGTGTGGWEAALTNT 125
302817764   1 MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTATSFIFPTTGTGAWESALTNT 80 
168021131  81 MSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEGIDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVR 160
168063179  81 LSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGAGIDLDVLKQKLVSDRSHSVKAVCVVHNETSTGVTNDIGAVR 160
168005939  81 LSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGTGVDLDNLKQKLQSDWSHSVKAVCVVHNETSTGVTNDIGAIR 160
159488202 124 LSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCR 203
159488204 113 LSPGDKVICFRYGLFSHLWIDMMQRLGLDVTVVDRPWGEGADEGALEELLRKDTGKKIKAVCVVHNETTTGVTSDIAGCR 192
159487068 127 VEPGDKVLVGNAGIWGERVGILSRRYNADVIELKTPAGTTFSYETLKAALTQ---HKPKVLFLCQGESSTGTHQSLAGLG 203
302774927  81 LSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGGVDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGVVR 160
302772394  81 LSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGGVDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGVVR 160
302844450 126 LSPGDKVVCFRYGLFSHLWIDMMQRLGLDVQVVDRPWGEGANEDILEEILRKDTEKKIKAVAVVHNETTTGVTSDIAGVR 205
302817764  81 LSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAGADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSIPSIR 160
168021131 161 KALDEARHPALLLVDGVSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKS 240
168063179 161 RVLDEANHPALLLVDGVSSIGAIDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGDYLKF 240
168005939 161 RVMDEARHPALLLVDGVSSIGAIDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGDYLKF 240
159488202 204 KAMDAAGHPALLLVDGVSSIGALEFKMDDWRVDVAVTGSQKAMSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADMLRT 283
159488204 193 KAMDAAGHPALLLVDGVSSIGALEFKMDDWRVDVAVTGSQKAMSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADMLRT 272
159487068 204 EV--CRQTGTLLLVDTVCSLGGVPLFADQWGVDCIYSGSQKCLSGPPGASPFFMSERAMEALQKRKSPPATYN----LDM 277
302774927 161 AILDSNQHPALLLVDGVSSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKS 240
302772394 161 AILDLNQHPALLLVDGVSSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKS 240
302844450 206 KAMDAANHPALLLVDGVSSIGALEFRMDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADMLRT 285
302817764 161 ALLDKHKHPALLLVDGVSSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKF 240
168021131 241 YKAGTYSPY--------TPSVQLLYGLRASLDIILkQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGV 312
168063179 241 YEAGTYWPY--------TPSSQMLYGLRASLDMILnEEGLDNVIARHCRLAEATRQAVRAWGLTLCTKDPKWKSDTVTAV 312
168005939 241 YEAGTYWPY--------TPSSQMLYGLRASLDMILnEEGLDNVIARHCRLGEATRQAVKAWGLTLCTQDPKWKSDTVTAV 312
159488202 284 NPSGNV-PY--------TPCLSLLYGLRESIKMWKeEGGMEAVAARHHRLAEGVRQAVDGWGLKLLCKNPRWRSDSLTVV 354
159488204 273 NPSGNV-PY--------TPCLSLLYGLRESIKMWKeEGGMEAVAARHHRLAEGVRQAVDGWGLKLLCKNPRWRSDSLTVV 343
159487068 278 NLIGDYWGWfgkrsyhhTGPVSTFYAMREALAIVS-EEGLEKLWQRHQDMHHRLWDGLRSMGLKPFVEKDEDRLITVNTI 356
302774927 241 YELGSYWPY--------TPSIQLLYGLRAALDLLF-EEGLENVIKRHHRLAHATRLAVKAWGLELCIKDPELYSDTVTAV 311
302772394 241 YELGSYWPY--------TPSIQLLYGLRAALDLLF-EEGLENVIKRHHRLAHATRLAVKAWGLELCVKDPELYSDTVTAV 311
302844450 286 NPSGNV-PY--------TPSLAMLYGMRESIKMLR-EEGMENVFARHHRLGEGARRAVEGWGLKLLCKNPRWRSDSLTVV 355
302817764 241 YKLGSYWPY--------TPSSQMLYALRASLDLIF-EEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRPEWNSDTVTAV 311
168021131 313 VVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLS 392
168063179 313 VVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNELQLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLA 392
168005939 313 VVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNELQMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLA 392
159488202 355 EVPEGVDSNKIVKNAYAKYDLSLGIGLASINGKVFRIGHLGNMNELMLAGALVGAEMAMIDSGISIKPGSGVARATEYWH 434
159488204 344 EVPEGVDSNKIVKNAYAKYDLSLGIGLASINGKVFRIGHLGNMNELMLAGALVGAEMAMIDSGISIKPGSGVARATEYWH 423
159487068 357 KVPEGVDWAAVVKHAMDTYSLEIAGGLGPTAGKVWRVGIMGFNAKPQ------NVDLVLTAFQDGLKRQGKL-------- 422
302774927 312 VVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVSAAQAYLQ 391
302772394 312 VVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVAAAQAYLQ 391
302844450 356 EVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNELMLVSALAGAEMAMIDAGVPIRPGSGVGKAIEYWQ 435
302817764 312 VVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQ 391
168021131 393 KQTPIIASRL 402
168063179 393 KKTPLIVSRI 402
168005939 393 KKTPLISSRI 402
159488202 435 KTGSVIKTRE 444
159488204 424 KTGSVIKTRE 433
159487068     ----------    
302774927 392 ESTPLIPSRL 401
302772394 392 ESTPLIPSRL 401
302844450 436 QTSSVIKTRE 445
302817764 392 KKTPLISSRL 401
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap