Conserved Protein Domain Family
PLN02404

?
PLN02404: PLN02404 
6,7-dimethyl-8-ribityllumazine synthase
Statistics
?
PSSM-Id: 178026
View PSSM: PLN02404
Aligned: 17 rows
Threshold Bit Score: 231.172
Threshold Setting Gi: 219117129
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223995843   1 SELDGSKLQIGILRTRWNDEHVSNLVDGIKAGLKGCKVDEDKIFIKEVPGAYELPYAAKLLAMSGTVDAIICCGVLIKGE 80 
168019764  80 SLMKGEGLKFGVVVGRFNEVITRPLLAGALDAFHRYQVREEDIDVIWVPGSFEIPVVAQQLALSKKYHSILCIGAVVRGA 159
159487499  69 SVMAEPGSKYAVVVARFNSLITKGLLEGAMETFEAHGVPKENVDVAWVPGSFEMPVIAKSMAKSGKYAGVVCIGAVIRGA 148
168004277  39 SLVKGAGLRFGVVVGRFNEIITKPLLAGALDAFYKHQVREEDIDVTWVPGSFEIPVVAQQLAMSKKYHAILCIGAVVRGA 118
225434247  72 SLTRAEGLRFAVVVARFNEIVTKLLLEGALETFKRYSVKEEDIDVVWVPGSFEIGVVAERLGKSKKYQAILCIGAVIRGD 151
224095325  32 SVTRTEGLRFAVVVARFNEIITRPLLEGAVATFKKYSVK-EDIDVVWVPGSFEIGIVAERLGKSGKYNAVVCIGAVVRGD 110
224117846  72 SVTKTEGFRFALVVARFNEIITRPLLEGAVATFKKYSVKEEDIDVVWVPGSFEIGIVAERLGKSGKYHAVVCIGAVVRGD 151
255581426  72 SLTRTEGLRFAVVVARFNEIVTKKLLEGALETFERYSVNEEDVDVVWVPGSFEIGVVAERLGKSRKYHAILCIGAVVRGD 151
302829641  69 SVMAEPLSKFAVVVAKFNSLITKGLLEGALEVFESHGVDKDNIDVVWVPGSFELPVVAKSMAKSGKYAGVVCIGAIIRGA 148
302818675   9 SILAADGLRFAVVAARFNDIITKPLVAGALEAFHRYSVKEEHIEVFWVPGSFEVPIVAQTLGKSGKFDAVVCIGAIVRGA 88 
223995843  81 TLHFEYISEAVSKGIMDVNLSTMTPVIYGVLNCLDEEQVKKRSSNENGghNHGEDWGKTAVEM 143
168019764 160 TTHYDAVANSAASGIMSASLKSNVPCIFGVLTTENMEQAIDRAGGKAG--NKGAEAAITALEM 220
159487499 149 TTHYDAVVSAATSGVLNCSVDTGVPVVFGVLTTDDLEQALDRTGGKVG--NKGGEAALTAVET 209
168004277 119 TTHYDAVANSAASGIMSASLKSNVPCIFGVLTTENMEQAIDRAGGKAG--NKGAEAAITALEM 179
225434247 152 TSHYDAVANSAASGVLSAGLNSGVPCIFGVLTCDDMDQALNRSGGKSG--NKGAEAALTAIEM 212
224095325 111 TTHYDAVANSAASGVLSAGLKSGVPCVFGVLTCEDMEQAINRAGGKSG--NKGAEAALTAIEM 171
224117846 152 TTHYDAVANSAASGVLSAGLNSGVPCIFGVLTCEDMEQAINRAGGKSG--NKGAEAALTAIEM 212
255581426 152 TTHYDAVANSAASGVLSAGLNSGVPCIFGVLTCDDMDQALNRAGGKAG--NKGAEGALTAIEM 212
302829641 149 TTHYDAVVSAATSGVLGASTDTGVPVIFGVLTTDDLEQALDRTGGKVG--NKGGEAALTAVEM 209
302818675  89 TSHYDAVANSAASGVMSASLNSGVPCVFGILTCDSMDQAFDRAGGKVG--NKGGEAAITAIEM 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap